CAZyme Information: HVAS_10021540.1-p1

Basic Information

• Species: Hemileia vastatrix
• Lineage: Basidiomycota; Pucciniomycetes; ; Zaghouaniaceae; Hemileia; Hemileia vastatrix
• CAZyme ID: HVAS_10021540.1-p1
• CAZy Family: CE4
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
498		56804.03	6.2391

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HvastatrixRaceXXXIII	12854	N/A	284	12570

• Gene Location: location=PHNK01002154:12991-15137(-)

Full Sequence      

MLIAPIDLADWLLPAFGSDSGFPPSFYPLEPLAGRVCLAEIGSLSLEFTHLAQHTGRKDY
FNAIQKITDTLDKSTWENGDRIGTLFPNYLNPTSKRFSDRTYTFGAGGDSYYEYLIKQYY
LVSGSLPQYAKMYAKAVDSAHKHLVRRLSIAEGQKKLTVIGDLVWDSYVPRIDHLTCFSG
AMIGLGSKLLGREKQDLPLAIENTDACVWSYESSATGIGAERLQILQDDAPYQWEPVIHQ
GKLIVNLIYSFANNVHVLFRFVVGKLYRQLAGSWPGGQADDARYLGRPETIESVFYMWRI
TGDRQWQDRGWRMFTKWMENSFTEFGFADILNVDQIPAPLDDSEESFVLAETSSFLLVIF
NLCLSLPRSSYISRFKYYFLLFSEPHFISLDEYVFNTEAHPFNINPRSTSATYSVSESKR
YSNPLRHFFGLERHKNQNKDHFKASNAQNAFASFWDGPDPSVDEIYDPPISNRFGKTKGW
GTLDQQWSRATKNETVIS

Enzyme Prediction     

No EC number prediction in HVAS_10021540.1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	6	363	1.6e-83	0.7174887892376681

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	2.23e-120	6	402	105	451	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	2.02e-81	6	406	181	520	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR39313.1|GH47	8.41e-93	1	402	506	883
CDZ96298.1|GH47	7.04e-83	1	407	335	700
SAM84424.1|GH47	2.66e-82	7	401	371	730
CDI56918.1|GH47	2.11e-80	7	421	561	939
CBQ69029.1|GH47	6.48e-79	7	401	371	730

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5KIJ_A	8.72e-37	7	404	113	451	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
1FMI_A	9.57e-37	7	404	118	456	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]
1FO2_A	9.87e-37	7	404	118	456	Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin [Homo sapiens],1FO3_A Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With Kifunensine [Homo sapiens]
1X9D_A	2.78e-36	7	404	196	534	Crystal Structure Of Human Class I alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue [Homo sapiens]
5KKB_A	2.92e-36	6	404	133	467	Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus],5KKB_B Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O18498|MA1A1_SPOFR	2.23e-41	7	408	311	648	Mannosyl-oligosaccharide alpha-1,2-mannosidase IA OS=Spodoptera frugiperda OX=7108 PE=1 SV=1
sp|Q9C512|MNS1_ARATH	2.05e-39	7	420	206	552	Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS1 OS=Arabidopsis thaliana OX=3702 GN=MNS1 PE=1 SV=1
sp|Q8H116|MNS2_ARATH	1.14e-38	6	416	206	549	Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS2 OS=Arabidopsis thaliana OX=3702 GN=MNS2 PE=1 SV=1
sp|P53624|MA1A1_DROME	1.99e-38	8	404	315	647	Mannosyl-oligosaccharide alpha-1,2-mannosidase IA OS=Drosophila melanogaster OX=7227 GN=alpha-Man-Ia PE=2 SV=2
sp|P39098|MA1A2_MOUSE	3.02e-38	6	401	292	623	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Mus musculus OX=10090 GN=Man1a2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000056	0.000000

TMHMM  Annotations     

There is no transmembrane helices in HVAS_10021540.1-p1.