CAZyme Information: HVAS_10008931.1-p1

Basic Information

• Species: Hemileia vastatrix
• Lineage: Basidiomycota; Pucciniomycetes; ; Zaghouaniaceae; Hemileia; Hemileia vastatrix
• CAZyme ID: HVAS_10008931.1-p1
• CAZy Family: AA5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
512		57880.84	8.7923

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HvastatrixRaceXXXIII	12854	N/A	284	12570

• Gene Location: location=PHNK01000893:5975-7771(+)

Full Sequence      

MTPSKLDRYHPRHPHASLLARLGGGLEQISAMEIKVLAGLTLLAGLVRTWAISNPTSIVF
DEVHFGGFATKYLKAEFFMDVHPPLAKLLIALIGWIFGLDKNFNFKDIGNDYAISNVPYI
PLRLLPAILGVLTVPVAYLTLRILTLHPLSASLGAIMLVFENGLITQSRFILLDSPLLFF
TSLSIFFHAGFSRIDNCFPQARFSKQWLSWLTLTGLSLGAVASCKWVGFFTIATIGLLTI
HQLWSRLGDRSIPMDIICRDFVARAISLIFIPFMFYLIVFQIHLLILNRSGDGDAFMSSE
FQHTLRGHGMPSTYADVLVGSNITIRHLNTHGGYLHSHPHYYPTGSHQQQITLYPHSDNN
NLWTVLPKLIEANTTTITRSSFVTNQMVFRLNHAETDKRLHSHDLRAPVTEVDYQNEVSA
YGFPGFPGDANDEWLIEIVSRASDPHDKAASTRLRSLRTKFRLRHTLQNCYLFSHKVKLP
AWGYDQQEVTCNKNPTWANSIWFVETNDHPLR

Enzyme Prediction     

EC	2.4.1.109:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	40	284	1.8e-69	0.9910313901345291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224839	PMT1	4.20e-150	47	510	37	482	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
396786	PMT	3.72e-75	47	288	10	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
397103	MIR	5.39e-41	336	504	13	185	MIR domain. The MIR (protein mannosyltransferase, IP3R and RyR) domain is a domain that may have a ligand transferase function.
197746	MIR	7.28e-12	459	507	8	57	Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases.
197746	MIR	8.68e-12	316	367	3	56	Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR39755.1|GT39	2.47e-208	12	511	96	603
KGB79961.1|GT39	2.47e-191	8	509	36	544
AUB24332.1|GT39	2.78e-190	8	509	36	544
AFR94643.1|GT39	2.78e-190	8	509	36	544
UOH80560.1|GT39	1.11e-189	8	509	36	544

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P25_A	8.06e-126	20	511	36	518	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_A Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6P25_B	2.22e-87	41	509	72	531	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_B Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6ZQQ_A	5.39e-29	316	509	14	205	Structure of the Pmt3-MIR domain with bound ligands [Saccharomyces cerevisiae],6ZQQ_B Structure of the Pmt3-MIR domain with bound ligands [Saccharomyces cerevisiae],6ZQQ_C Structure of the Pmt3-MIR domain with bound ligands [Saccharomyces cerevisiae],6ZQQ_D Structure of the Pmt3-MIR domain with bound ligands [Saccharomyces cerevisiae]
6P28_A	1.28e-28	316	509	5	195	Crystal structure of the MIR domain (aa 337-532) of the S. cerevisiae mannosyltransferase Pmt2 [Saccharomyces cerevisiae]
6ZQP_A	2.03e-28	316	509	22	212	Structure of the Pmt2-MIR domain with bound ligands [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O74189|PMT1_CANAL	6.20e-137	5	511	42	532	Dolichyl-phosphate-mannose--protein mannosyltransferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT1 PE=2 SV=1
sp|P33775|PMT1_YEAST	4.15e-125	20	511	36	518	Dolichyl-phosphate-mannose--protein mannosyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT1 PE=1 SV=1
sp|P52867|PMT5_YEAST	2.45e-110	26	511	37	514	Dolichyl-phosphate-mannose--protein mannosyltransferase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT5 PE=1 SV=1
sp|Q8BGQ4|POMT2_MOUSE	3.93e-93	37	510	131	594	Protein O-mannosyl-transferase 2 OS=Mus musculus OX=10090 GN=Pomt2 PE=1 SV=1
sp|P47190|PMT3_YEAST	7.84e-92	41	509	65	525	Dolichyl-phosphate-mannose--protein mannosyltransferase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT3 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.995940	0.004063

TMHMM  Annotations     

Start	End
77	99
120	139
143	165
170	192
207	229
265	287