CAZyme Information: HMPREF1544_11902-t46_1-p1

Basic Information

• Species: Mucor circinelloides
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor circinelloides
• CAZyme ID: HMPREF1544_11902-t46_1-p1
• CAZy Family: GT71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
557	KE124179|CGC1	61173.43	6.2847

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mcircinelloides1006PhL	12410	1220926	183	12227

• Gene Location: location=KE124179:25716-27552(-)

Full Sequence      

MPRRAPSEANLGRFDFVIVGGGTAGCVLANRLSSNGKHSVIVLESGANTQEELLNVRVPL
FNSKLKNTNVDWQLKSVTQQHADGRSIGIPQGKMLGGSSAINACLSHRCSPSDYDAWNMP
GWEYEQLKHYFCKAETFQDDTTTMAKDLHGQSGPLNVMQQSDDSLLAKHFTKACQNHGIP
QYHDITDVPCQIGVTGIQSTVYRGERTSTGSAYLPPDIQQNRPNLSIALNCTVKRIVIDQ
STNAVTHVEYTSNTDGELYRVSVSKEAILSAGAILSPLLLLSSGIGSRSELERLGIEVIA
DLPGVGKNLQNHWRVPLVHETTRPEMSLHQSIFEKERESLERITDANEPSALSRAWPDAV
AYMKVPDSPDNSSSLTNTPQIELFTGGLALCRELPKLKDVACASVLMVYIAPFSKGSVTL
NSDRTPHIDLALLQDERDLQCIEKGLELSIKIADDEGYIKNCIKRWILHPYKAEEKQDIK
QYIKDHIDTLHHYAGTCKMGPATDRDAVVDGNLKVHGIHGLRVVDASFFPIVPAGQICFP
VIACAEKASDLILNDCI

Enzyme Prediction     

No EC number prediction in HMPREF1544_11902-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	13	555	7.7e-148	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.16e-94	14	555	8	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	2.09e-89	13	553	5	532	choline dehydrogenase; Validated
274888	Rv0697	6.86e-58	15	553	2	487	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	6.33e-32	412	548	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	4.27e-22	14	529	56	553	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO20017.1|AA3_2	8.01e-80	13	552	81	639
QRV90274.1|AA3_2	3.20e-78	5	555	33	602
QDS69953.1|AA3_2	4.19e-77	10	552	72	640
QWC20507.1|AA3_2	2.18e-76	14	552	6	524
CDI52744.1|AA3_2	2.34e-75	14	554	36	614

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YS2_AAA	1.01e-66	13	552	7	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6ZH7_A	1.41e-66	13	552	7	560	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YRU_AAA	1.41e-66	13	552	7	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS1_AAA	1.41e-66	13	552	7	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
5NCC_A	1.96e-66	13	552	23	576	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A8JHB7|FAP_CHLRE	2.56e-69	3	552	35	596	Fatty acid photodecarboxylase, chloroplastic OS=Chlamydomonas reinhardtii OX=3055 GN=FAP PE=1 SV=1
sp|Q47944|SDH_GLUOY	6.61e-68	14	552	5	527	L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans OX=442 PE=3 SV=1
sp|A0A248QE08|FAP_CHLVA	3.22e-65	13	552	83	636	Fatty acid photodecarboxylase, chloroplastic OS=Chlorella variabilis OX=554065 GN=FAP PE=1 SV=1
sp|A0A3B1EFP9|STR4_STRTC	3.01e-64	14	552	36	611	Dehydrogenase str4 OS=Strobilurus tenacellus OX=41251 GN=str4 PE=1 SV=1
sp|Q6UPE0|CHDH_RAT	4.26e-64	14	552	46	576	Choline dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Chdh PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000060	0.000006

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1544_11902-t46_1-p1.