CAZyme Information: HMPREF1544_11864-t46_1-p1

Basic Information

• Species: Mucor circinelloides
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor circinelloides
• CAZyme ID: HMPREF1544_11864-t46_1-p1
• CAZy Family: GT71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
284		31490.93	4.3637

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mcircinelloides1006PhL	12410	1220926	183	12227

• Gene Location: location=KE124176:28502-29524(+)

Full Sequence      

MLVSYISAGLLAISSALTVQARYIDYSAASTAALFRRDDASGCRNMNTNFVETTEGWVLQ
KGSTAETYDTTSEGLEMRILKPKEYESSYEAAIDEDTPNKLRYNKYEGRGFTFNATTYMK
YGKFSATVKSAKVPGAVTAVILIADNGDEIDFELLAGPAQQITSNYFYGPHIVYGENGEV
IDAPRGNVYDQFYKYTIEWSPTEIVWKIDDQEIRTVTLEETDPKNGDEPAYPTHAARVQI
GLWDGSGASGTAEWARGPIDWSKQDGPVTAYIKDVVIECDPKHN

Enzyme Prediction     

No EC number prediction in HMPREF1544_11864-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	106	260	1.8e-37	0.8908045977011494

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185692	GH16_fungal_CRH1_transglycosylase	1.49e-41	107	279	33	201	glycosylphosphatidylinositol-glucanosyltransferase. Group of fungal GH16 members related to Saccharomyces cerevisiae Crh1p. Chr1p and Crh2p are transglycosylases that are required for the linkage of chitin to beta(1-3)glucose branches of beta(1-6)glucan, an important step in the assembly of new cell wall. Both have been shown to be glycosylphosphatidylinositol (GPI)-anchored. A third homologous protein, Crr1p, functions in the formation of the spore wall. They belongs to the family 16 of glycosyl hydrolases that includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
395585	Glyco_hydro_16	8.58e-29	112	263	24	168	Glycosyl hydrolases family 16.
185683	Glyco_hydrolase_16	1.43e-17	110	261	57	206	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185684	GH16_lichenase	9.30e-15	121	275	68	208	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
185685	GH16_XET	3.38e-11	105	278	34	201	Xyloglucan endotransglycosylase, member of glycosyl hydrolase family 16. Xyloglucan endotransglycosylases (XETs) cleave and religate xyloglucan polymers in plant cell walls via a transglycosylation mechanism. Xyloglucan is a soluble hemicellulose with a backbone of beta-1,4-linked glucose units, partially substituted with alpha-1,6-linked xylopyranose branches. It binds noncovalently to cellulose, cross-linking the adjacent cellulose microfibrils, giving it a key structural role as a matrix polymer. Therefore, XET plays an important role in all plant processes that require cell wall remodeling.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS10243.1|GH16	1.45e-70	32	284	21	270
CDS13191.1|GH16	3.55e-70	43	284	29	261
CDS12756.1|GH16	1.07e-36	108	284	2	141
VWO96434.1|GH16	5.16e-32	67	279	848	1052
BCS29145.1|CBM18|GH16_19	1.29e-29	107	279	122	300

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IBU_A	2.01e-24	107	278	56	222	Apo Crh5 transglycosylase [Aspergillus fumigatus Af293],6IBU_B Apo Crh5 transglycosylase [Aspergillus fumigatus Af293],6IBW_A Crh5 transglycosylase in complex with NAG [Aspergillus fumigatus Af293],6IBW_B Crh5 transglycosylase in complex with NAG [Aspergillus fumigatus Af293]
3HR9_A	5.91e-07	119	263	16	154	Chain A, Beta-glucanase [Fibrobacter succinogenes]
3H0O_A	1.93e-06	119	263	15	153	Chain A, Beta-glucanase [Fibrobacter succinogenes]
3AXD_A	2.05e-06	120	263	19	156	The truncated Fibrobacter succinogenes 1,3-1,4-beta-D-glucanase V18Y/W203Y in apo-form [Fibrobacter succinogenes subsp. succinogenes S85],3AXD_B The truncated Fibrobacter succinogenes 1,3-1,4-beta-D-glucanase V18Y/W203Y in apo-form [Fibrobacter succinogenes subsp. succinogenes S85],3AXE_A The truncated Fibrobacter succinogenes 1,3-1,4-beta-D-glucanase V18Y/W203Y in complex with cellotetraose (cellobiose density was observed) [Fibrobacter succinogenes subsp. succinogenes S85]
2R49_A	3.52e-06	119	263	16	154	Chain A, Beta-glucanase [Fibrobacter succinogenes]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WI46|CRF2_ASPFU	2.27e-27	118	279	133	300	Probable glycosidase crf2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=crf2 PE=1 SV=1
sp|Q5AJC0|UTR2_CANAL	1.47e-23	110	275	129	298	Extracellular glycosidase UTR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=UTR2 PE=1 SV=1
sp|Q8J0P4|CRF1_ASPFU	1.01e-22	107	278	77	243	Probable glycosidase crf1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=crf1 PE=1 SV=2
sp|Q75A41|CRR1_ASHGO	1.98e-17	110	277	186	359	Probable glycosidase CRR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=CRR1 PE=3 SV=1
sp|D4ALQ5|CRH11_ARTBC	5.17e-17	118	277	83	235	Probable extracellular glycosidase ARB_05253 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05253 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000335	0.999626	CS pos: 21-22. Pr: 0.9663

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1544_11864-t46_1-p1.