CAZyme Information: HMPREF1544_11800-t46_1-p1

Basic Information

• Species: Mucor circinelloides
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor circinelloides
• CAZyme ID: HMPREF1544_11800-t46_1-p1
• CAZy Family: GT71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
673		71216.38	9.3769

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mcircinelloides1006PhL	12410	1220926	183	12227

• Gene Location: location=KE124171:11496-13678(+)

Full Sequence      

MFGHCTFTHLAAAATTAIALLAMSSVHAASFLDKPSVVTYWGQNSKGSSDSQKSLASYCD
NNSDVLIMSFVLDFNDGSLPMLNLANGCNGPTFSGTELLQCTGVAADIKTCQDKGKTILI
SLGGANGVYGFANDANAEAFADTLWNIFGAGESDTRPFGDAVIDGFDLDIEGGGSTGYVA
MIKRLRKHFATDSSKEYYITGAPQCPYPDAMLGTILDAVEFDAVNVQFYNNYCSTTSSSF
NFDTWNTWAKSSPNSKVKVFLGVPGSDTAAGSGYVAFDSLEPIVKELQSTYSNFGGVTLW
DASASYANTDVSPNYQAGVADLVHGLSGDDGDDETSTSATKKHTTKSHHKTTSKTKHHKT
TQASHRSSVSTTRSILNTSKATRTKPSKSTSASSTAAKSTFSKTKTSNHSKYTHRRTTTK
TKSKTTSKATKSKIIKSKTIKSTSIDRSSTKSKSTTTKAKPTKTLTSTSESNTASPISCV
LNDSKCSTEGQIVCSGDSFATCNHGRWKLRQCPSSLTCFSTTDGTSVYCGQGTSGTTCPA
FKSNLLVEATSLSADSKQTSFVGPTAKPYKNGRVIAQFSVTKSDAGSFEAVINARRLDQK
SFGNTVVVSFKVADNIKITSVAGGTVSQTGNQVKIQYKNGSKKTMVAIVGIEGKVSTDNV
LVAPNVNSMKFSS

Enzyme Prediction     

EC	3.2.1.14:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	37	307	6.7e-28	0.7837837837837838

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119356	GH18_hevamine_XipI_class_III	6.13e-118	37	321	3	280	This conserved domain family includes xylanase inhibitor Xip-I, and the class III plant chitinases such as hevamine, concanavalin B, and PPL2, all of which have a glycosyl hydrolase family 18 (GH18) domain. Hevamine is a class III endochitinase that hydrolyzes the linear polysaccharide chains of chitin and peptidoglycan and is important for defense against pathogenic bacteria and fungi. PPL2 (Parkia platycephala lectin 2) is a class III chitinase from Parkia platycephala seeds that hydrolyzes beta(1-4) glycosidic bonds linking 2-acetoamido-2-deoxy-beta-D-glucopyranose units in chitin.
395573	Glyco_hydro_18	5.58e-25	37	304	2	264	Glycosyl hydrolases family 18.
119350	GH18_chitinase_D-like	3.58e-19	37	317	3	311	GH18 domain of Chitinase D (ChiD). ChiD, a chitinase found in Bacillus circulans, hydrolyzes the 1,4-beta-linkages of N-acetylglucosamine in chitin and chitodextrins. The domain architecture of ChiD includes a catalytic glycosyl hydrolase family 18 (GH18) domain, a chitin-binding domain, and a fibronectin type III domain. The chitin-binding and fibronectin type III domains are located either N-terminal or C-terminal to the catalytic domain. This family includes exochitinase Chi36 from Bacillus cereus.
119349	GH18_chitinase-like	8.03e-17	37	303	1	208	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
119363	GH18_CTS3_chitinase	1.60e-10	164	301	114	252	GH18 domain of CTS3 (chitinase 3), an uncharacterized protein from the human fungal pathogen Coccidioides posadasii. CTS3 has a chitinase-like glycosyl hydrolase family 18 (GH18) domain; and has homologs in bacteria as well as fungi.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS10560.1|CBM19|GH18	1.66e-166	26	671	18	568
BAA01021.1|CBM19|GH18|3.2.1.14	1.39e-142	19	671	13	539
BAA01022.1|CBM19|GH18|3.2.1.14	1.32e-137	19	671	13	541
BAA01018.1|CBM19|GH18	3.85e-105	37	672	29	493
ANB12166.1|GH18	1.45e-96	37	314	26	313

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2UY2_A	2.99e-79	37	308	8	272	ScCTS1_apo crystal structure [Saccharomyces cerevisiae],2UY3_A ScCTS1_8-chlorotheophylline crystal structure [Saccharomyces cerevisiae],2UY4_A ScCTS1_acetazolamide crystal structure [Saccharomyces cerevisiae],2UY5_A ScCTS1_kinetin crystal structure [Saccharomyces cerevisiae],4TXE_A ScCTS1 in complex with compound 5 [Saccharomyces cerevisiae]
4TOQ_A	1.06e-50	37	300	3	257	Crystal structure of class III chitinase from pomegranate provides the insight into its metal storage capacity [Punica granatum],4TOQ_B Crystal structure of class III chitinase from pomegranate provides the insight into its metal storage capacity [Punica granatum],4TOQ_C Crystal structure of class III chitinase from pomegranate provides the insight into its metal storage capacity [Punica granatum],4TOQ_D Crystal structure of class III chitinase from pomegranate provides the insight into its metal storage capacity [Punica granatum]
1HVQ_A	7.13e-48	37	300	3	255	CRYSTAL STRUCTURES OF HEVAMINE, A PLANT DEFENCE PROTEIN WITH CHITINASE AND LYSOZYME ACTIVITY, AND ITS COMPLEX WITH AN INHIBITOR [Hevea brasiliensis],1LLO_A Chain A, HEVAMINE [Hevea brasiliensis],2HVM_A Hevamine A At 1.8 Angstrom Resolution [Hevea brasiliensis]
4TX6_A	1.02e-47	34	323	1	308	AfChiA1 in complex with compound 1 [Aspergillus fumigatus A1163],4TX6_B AfChiA1 in complex with compound 1 [Aspergillus fumigatus A1163]
2XVN_A	1.38e-47	40	323	6	307	A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus],2XVN_B A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus],2XVN_C A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P29026|CHI1_RHIOL	2.48e-143	19	671	13	539	Chitinase 1 OS=Rhizopus oligosporus OX=4847 GN=CHI1 PE=1 SV=1
sp|P29027|CHI2_RHIOL	2.34e-138	19	671	13	541	Chitinase 2 OS=Rhizopus oligosporus OX=4847 GN=CHI2 PE=1 SV=1
sp|P29025|CHI1_RHINI	6.83e-106	37	672	29	493	Chitinase 1 OS=Rhizopus niveus OX=4844 GN=CHI1 PE=3 SV=1
sp|P40954|CHI3_CANAL	1.90e-80	37	323	25	310	Chitinase 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CHT3 PE=1 SV=2
sp|P40953|CHI2_CANAL	1.54e-78	6	310	3	288	Chitinase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CHT2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000600	0.999399	CS pos: 28-29. Pr: 0.9775

TMHMM  Annotations     

Start	End
7	29