CAZyme Information: HMPREF1544_11707-t46_1-p1

Basic Information

• Species: Mucor circinelloides
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor circinelloides
• CAZyme ID: HMPREF1544_11707-t46_1-p1
• CAZy Family: GT62
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
759	KE124164|CGC1	86730.76	9.6921

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mcircinelloides1006PhL	12410	1220926	183	12227

• Gene Location: location=KE124164:3595-6312(-)

Full Sequence      

MGNKQNELKKRKAVTTVPNKEPSHTQEINEDIDAIKKHIKYQGGANNETKHKVASTAVTI
MSFFTTFYMIWYPAQVVFDEVHFGKFAGYYLQRTFFFDVHPPLAKLMLAGVGYLSGFDGV
YQFANIGESYAANNVPYIALRALPASLNVCGVALIYNILKESGFSVLTCFTTATLYLLDN
AFIGQNRLILLDSILIFYMLTTVYSYVKFRKYRHQPFTLSWWTWMMATGTSMALTLSVKM
IGLFVVAAVGLAVVMDLWDLLDKKKYGLNNKTLIQHLGARIAGLILLPAVVYLFWFYIHF
AILKFSGPGDAYMSTRFQDTLTNNPLRINSLDIMYNQSIKLQHKETRAFLHSHTLTYPAR
YEDGRYSSQGIQVTGNMQPDINSYWRIKPTGPIDETVAAKRPVKHNDIIQLEHIGTGLDL
LTHDVASPWMPTNQEFTTTKLAARYNETLFRVELDGYKVNPVWSTLMQSVKLIHVRTGVA
LWCNNRNLPDWGLNHMEINGNKKSGEERNYWVATDILGLNATDINLKKQEKKVIKQMGFL
SKFLELQIKMITHNNKLTGSHPYQSSPSIWPFMLRGISYWTKDDTQSQIYLTGNVAGWWS
ALVAICLFSFVSVLDMALKKREILIMSETSRIRLNRSGGFFLLLWATHYFPFYLMGRSLY
LHHYLPAMACSYMLLGAVFEYLFVDGVNSPVSYQPTDKKYTINQARTTIKSYIAAFVLIS
MQFMVYLFLSPLTYGTPGMSAEEAMRHKVLKSWDIQYGK

Enzyme Prediction     

EC	2.4.1.109:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	58	300	4e-62	0.9910313901345291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224839	PMT1	2.27e-175	49	759	21	699	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
396786	PMT	7.81e-73	57	303	2	244	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
406576	PMT_4TMC	1.45e-68	541	742	1	190	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
397103	MIR	4.64e-07	349	493	11	163	MIR domain. The MIR (protein mannosyltransferase, IP3R and RyR) domain is a domain that may have a ligand transferase function.
197746	MIR	2.46e-05	335	389	6	56	Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS13311.1|GT39	4.56e-294	16	759	19	759
AAP05785.1|GT39|2.4.1.109	8.62e-226	48	759	51	773
QPC75087.1|GT39	1.56e-225	18	759	18	770
UKZ66606.1|GT39	2.29e-225	42	759	45	771
AAR99494.1|GT39|2.4.1.109	2.44e-225	48	759	51	773

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P25_A	7.02e-89	50	754	48	728	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_A Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6P25_B	1.60e-86	59	680	72	694	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_B Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P46971|PMT4_YEAST	1.16e-189	33	745	34	749	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT4 PE=1 SV=1
sp|O42933|PMT4_SCHPO	1.71e-187	16	759	33	776	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ogm4 PE=3 SV=1
sp|Q59X23|PMT4_CANAL	1.06e-182	48	759	44	755	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT4 PE=2 SV=2
sp|F1QF89|POMT1_DANRE	9.40e-112	57	755	20	715	Protein O-mannosyl-transferase 1 OS=Danio rerio OX=7955 GN=pomt1 PE=1 SV=1
sp|Q99PR0|POMT1_RAT	2.61e-111	57	755	43	742	Protein O-mannosyl-transferase 1 OS=Rattus norvegicus OX=10116 GN=Pomt1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999701	0.000278

TMHMM  Annotations     

Start	End
53	75
95	117
137	159
164	183
188	207
233	255
276	298
595	614
634	656
671	693
713	735