CAZyme Information: HMPREF1544_11634-t46_1-p1

Basic Information

• Species: Mucor circinelloides
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor circinelloides
• CAZyme ID: HMPREF1544_11634-t46_1-p1
• CAZy Family: GT62
• CAZyme Description: cytochrome c peroxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
272		30583.38	5.0739

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mcircinelloides1006PhL	12410	1220926	183	12227

• Gene Location: location=KE124158:25779-26763(-)

Full Sequence      

MSTSQASPDKYTEVREDIAKAFPNEDYDDGSFAPVVLRLAWHASGTYDKNHKDGGSDGAT
MRYKAEAEDPANAGLEHARHFLDPIKAKHTWISYADLWTLAGCVAVEQMGGPHIEWTGGR
RDKANETDCPPLGRLPDAALGKDHVLDVFVSRMGFTVQETVALIGAHTVGRCHADRSGFD
GPWTYNPTRFSNQFYKLLLNVTWVEKKWDGPKQFVDEDEGEIMMLPTDMALLEEPFRQYV
ELYAKDQQKFFDDFAAAFLKLIELGVAKRSKM

Enzyme Prediction     

No EC number prediction in HMPREF1544_11634-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	13	266	6.1e-62	0.984313725490196

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173825	ascorbate_peroxidase	9.91e-126	8	266	10	250	Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water.
178218	PLN02608	1.94e-83	33	270	31	248	L-ascorbate peroxidase
178467	PLN02879	3.73e-66	11	269	6	250	L-ascorbate peroxidase
166005	PLN02364	8.06e-66	33	265	33	246	L-ascorbate peroxidase 1
173823	plant_peroxidase_like	1.13e-57	13	263	2	255	Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UOP57177.1|AA2	6.80e-109	14	266	10	268
BDA47129.1|AA2	6.85e-109	4	266	81	346
UOP56908.1|AA2	7.03e-109	14	266	10	268
QNP98603.1|AA2	3.00e-108	11	268	6	263
BCS01357.1|AA2	3.12e-107	6	271	2	274

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5AMM_A	3.81e-71	34	271	27	264	Structure of Leishmania major peroxidase D211N mutant [Leishmania major],5AMM_B Structure of Leishmania major peroxidase D211N mutant [Leishmania major]
3RIV_A	1.58e-70	3	271	1	265	The Crystal Structure of Leishmania major Peroxidase [Leishmania major strain Friedlin],3RIV_B The Crystal Structure of Leishmania major Peroxidase [Leishmania major strain Friedlin]
4GED_A	2.03e-70	34	271	27	264	Crystal Structure of the Leishmania Major Peroxidase-Cytochrome C Complex [Leishmania major]
5AL9_A	3.06e-70	34	271	27	264	Structure of Leishmania major peroxidase D211R mutant (high res) [Leishmania major],5ALA_A Structure of Leishmania major peroxidase D211R mutant (low res) [Leishmania major],5ALA_B Structure of Leishmania major peroxidase D211R mutant (low res) [Leishmania major]
1JCI_A	3.18e-70	24	266	33	274	Chain A, Cytochrome C Peroxidase [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4PD66|CCPR2_USTMA	2.74e-112	11	266	7	268	Putative heme-binding peroxidase OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CCP2 PE=3 SV=1
sp|Q6CAB5|CCPR2_YARLI	5.34e-109	11	268	6	263	Putative cytochrome c peroxidase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=YALI0D04268g PE=3 SV=1
sp|Q5B1Z0|CCPR2_EMENI	1.53e-107	6	268	2	271	Putative heme-binding peroxidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=AN5440 PE=3 SV=1
sp|P0C0V3|CCPR_EMENI	2.33e-103	2	272	79	351	Cytochrome c peroxidase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ccp1 PE=3 SV=1
sp|Q4WLG9|CCPR2_ASPFU	1.07e-102	6	268	2	271	Putative heme-binding peroxidase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=AFUA_6G13570 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000062	0.000000

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1544_11634-t46_1-p1.