CAZyme Information: HMPREF1544_11580-t46_1-p1

Basic Information

• Species: Mucor circinelloides
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor circinelloides
• CAZyme ID: HMPREF1544_11580-t46_1-p1
• CAZy Family: GT62
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360	KE124154|CGC1	42732.67	8.0373

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mcircinelloides1006PhL	12410	1220926	183	12227

• Gene Location: location=KE124154:26490-27572(-)

Full Sequence      

MVQLIPIIYWTTWFHTNQWEGYNIDTCGLPYHCQLTHDRNQLSDSSVVIFHASDMDGGKK
DMPPIKENRAWVYHNAEAPKHQPDIIDKMQYSMTYRLDSDFPWGYLEKDYLLQRMQKPVN
KQRFKRKTPVAWIVSNCKASNYRHHYVRELSKWIDVDVYGHCMNNQHYPDNTTTVDLISQ
YHFYLSFENSNCKDYVTEKLSNAYVAATIPIVDGPSDYGPFIPNTRSVIRVDQFEHPKEL
AAYLQKVLADTNLYDSYFEYRRENGLSDRFIATLDAYEQGKCNLCKLAYERYTDMSLYYP
GKKIYLDNTCIDYKHYSFTQTRVWRIYLPLMVLIMIVGLCFSKVRRYSYSKLKSVHVPFF

Enzyme Prediction     

EC	2.4.1.214:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT10	7	290	1.4e-75	0.8443804034582133

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395683	Glyco_transf_10	1.21e-49	125	286	1	157	Glycosyltransferase family 10 (fucosyltransferase) C-term. This is the C-terminal domain of a family of fucosyltransferases. This enzyme transfers fucose from GDP-Fucose to GlcNAc in an alpha1,3 linkage. This family is known as glycosyltransferase family 10. The C-terminal domain is the likely binding-region for ADP (manuscript in publication).
407214	Glyco_tran_10_N	2.08e-17	7	105	6	108	Fucosyltransferase, N-terminal. This is the N-terminal domain of a family of fucosyltransferases. This enzyme transfers fucose from GDP-Fucose to GlcNAc in an alpha1,3 linkage. This family is known as glycosyltransferase family 10. The N-terminal domain is the likely binding-region for the fucose-like substrate (manuscript in publication).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS03884.1|GT10	3.39e-48	90	320	22	269
CAK50261.1|GT10|2.4.1.152	4.98e-39	7	303	52	379
CAD7228511.1|GT10	1.19e-38	33	290	19	268
AEO33641.1|GT10	2.29e-37	5	289	59	344
AEE61590.1|GT10	2.87e-37	33	261	158	390

PDB Hits     

HMPREF1544_11580-t46_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q99JB3|FUT9_RAT	1.63e-35	20	263	75	321	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase 9 OS=Rattus norvegicus OX=10116 GN=Fut9 PE=1 SV=1
sp|O88819|FUT9_MOUSE	2.27e-35	20	263	75	321	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase 9 OS=Mus musculus OX=10090 GN=Fut9 PE=1 SV=1
sp|Q8HZR2|FUT9_BOVIN	2.27e-35	20	263	75	321	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase 9 OS=Bos taurus OX=9913 GN=FUT9 PE=2 SV=1
sp|Q659L1|FUT9_CANLF	6.12e-35	20	263	75	321	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase 9 OS=Canis lupus familiaris OX=9615 GN=FUT9 PE=2 SV=1
sp|Q659L0|FUT9_PANTR	6.12e-35	20	263	75	321	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase 9 OS=Pan troglodytes OX=9598 GN=FUT9 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.946610	0.053412

TMHMM  Annotations     

Start	End
323	342