CAZyme Information: HMPREF1544_11566-t46_1-p1

Basic Information

• Species: Mucor circinelloides
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor circinelloides
• CAZyme ID: HMPREF1544_11566-t46_1-p1
• CAZy Family: GT59
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
436	KE124153|CGC1	50517.51	9.3619

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mcircinelloides1006PhL	12410	1220926	183	12227

• Gene Location: location=KE124153:27796-29322(-)

Full Sequence      

MNALFSRLTFNKLCIAAFALRVALLLYGEYQDAYFTVKYTDIDYVVFTDAARYITEGKSP
YLRETYRYTPLLAILLTPNIFWFKSFGKCLFASADLLCGYLIHRILVLRGMRSKSALKFD
ALWLLNPMVANISTRGNAESLLGVMVLGTFYLVLTRRYFYSACLVFGLSVHFKIYPVIYA
IPLLMLLDDHYGNPFQQSSFLQLAEKDSTTTKIMRGIIVFLSPVRILFGFISAFVFFALT
ASMYQQYGDEFMQHTYLYHVTREDHRHNFSIWFYQMYLGIDNTSPWMGLVAFVPQLALVT
IIGIAFGKDLFFATFVQTFIFVTFNKVITSQYFMWYICLFPLILPSSKMKFKWKGLLLLL
AWVAGQGLWLNFAYQLEFLGQNTFLQLWIAGVTFFIVNCWIVVELILNHQYEPIYGSSGR
IRWVWGNGDPGSRRSL

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	132	406	3.4e-97	0.9961832061068703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	4.94e-129	8	415	6	424	GPI mannosyltransferase
252941	Mannosyl_trans	5.94e-80	132	406	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.
399599	PIG-U	4.50e-04	49	324	39	306	GPI transamidase subunit PIG-U. Many eukaryotic proteins are anchored to the cell surface via glycosylphosphatidylinositol (GPI), which is posttranslationally attached to the carboxyl-terminus by GPI transamidase. The mammalian GPI transamidase is a complex of at least four subunits, GPI8, GAA1, PIG-S, and PIG-T. PIG-U is thought to represent a fifth subunit in this complex and may be involved in the recognition of either the GPI attachment signal or the lipid portion of GPI.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS07286.1|GT50	3.10e-204	9	436	7	486
AWP20910.1|GT50	3.82e-119	1	410	1	401
CBN81774.1|GT50	5.40e-119	1	410	1	401
AFO97651.1|GT50	1.32e-116	12	414	6	414
AAH81324.1|GT50	2.27e-114	17	412	21	412

PDB Hits     

HMPREF1544_11566-t46_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q66IJ4|PIGM_XENTR	4.03e-115	17	412	21	412	GPI mannosyltransferase 1 OS=Xenopus tropicalis OX=8364 GN=pigm PE=2 SV=1
sp|Q9H3S5|PIGM_HUMAN	2.94e-113	17	414	25	416	GPI mannosyltransferase 1 OS=Homo sapiens OX=9606 GN=PIGM PE=1 SV=1
sp|Q5RAH7|PIGM_PONAB	2.94e-113	17	414	25	416	GPI mannosyltransferase 1 OS=Pongo abelii OX=9601 GN=PIGM PE=2 SV=1
sp|Q5EA10|PIGM_BOVIN	6.68e-112	15	414	23	416	GPI mannosyltransferase 1 OS=Bos taurus OX=9913 GN=PIGM PE=2 SV=1
sp|Q4R4E1|PIGM_MACFA	9.45e-112	17	414	25	416	GPI mannosyltransferase 1 OS=Macaca fascicularis OX=9541 GN=PIGM PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000023	0.000014

TMHMM  Annotations     

Start	End
13	30
66	83
90	112
132	154
159	181
217	239
285	307
327	346
353	370
385	407