CAZyme Information: HMPREF1544_11555-t46_1-p1

Basic Information

• Species: Mucor circinelloides
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor circinelloides
• CAZyme ID: HMPREF1544_11555-t46_1-p1
• CAZy Family: GT58
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
294	KE124153|CGC1	33274.28	10.5594

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mcircinelloides1006PhL	12410	1220926	183	12227

• Gene Location: location=KE124153:2710-3768(-)

Full Sequence      

MLKSNYLILLAVTLMCLFSSIEAGKTKTWKFYNWNRFNGKATVGKGSNWDKAWGIPEHGG
WLWFWKNADKLKSITYKNSKKDYVLRVTYPKGSRNPEANPIGGLGFKAEPLKIDNKVKTV
EFQYSVYFPKGFNFVRGGKLPGLYGGHGDCTGGIDSNKCFTTRVMWRDRGEGEVYAYLPS
SKQRSNLCDNKVNICNPDYGYSLGRGTFKFKTGKWVSVRQVLTINTVGKQNGKLSLYING
KLATTQTKLVFRTNSTGRVAGIMFHTFFGGSDKTWKTPKTQYSYFKNFSLKTIS

Enzyme Prediction     

EC	4.2.2.26:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL14	82	292	3.7e-62	0.975

CDD Domains     

HMPREF1544_11555-t46_1-p1 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS05384.1|PL14_3	2.46e-109	25	291	26	287
CDS02791.1|PL14_3	9.88e-94	7	290	6	285
BAC87758.1|PL14|4.2.2.3	1.10e-56	74	294	51	266
AKK25357.1|PL14	1.10e-56	74	294	51	266
BAE45131.1|PL14	3.10e-56	74	292	51	264

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5GMT_A	4.64e-48	69	294	45	274	Crystal structure of the marine PL-14 alginate lyase from Aplysia kurodai [Aplysia kurodai],5GMT_B Crystal structure of the marine PL-14 alginate lyase from Aplysia kurodai [Aplysia kurodai]
3A0N_A	1.40e-19	59	291	15	241	Crystal structure of D-glucuronic acid-bound alginate lyase vAL-1 from Chlorella virus [Paramecium bursaria Chlorella virus CVK2],3GNE_A Crystal structure of alginate lyase vAL-1 from Chlorella virus [Paramecium bursaria Chlorella virus CVK2],3GNE_B Crystal structure of alginate lyase vAL-1 from Chlorella virus [Paramecium bursaria Chlorella virus CVK2],3IM0_A Crystal structure of Chlorella virus vAL-1 soaked in 200mM D-glucuronic acid, 10% PEG-3350, and 200mM glycine-NaOH (pH 10.0) [Paramecium bursaria Chlorella virus CVK2]
6KCW_A	1.63e-11	33	293	9	240	Structure of alginate lyase Aly36B [Chitinophaga sp. MD30]
6KCV_A	1.03e-10	33	293	9	240	Structure of alginate lyase Aly36B mutant K143A/Y185A in complex with alginate tetrasaccharide [Chitinophaga sp. MD30],6KCV_B Structure of alginate lyase Aly36B mutant K143A/Y185A in complex with alginate tetrasaccharide [Chitinophaga sp. MD30],6KCV_C Structure of alginate lyase Aly36B mutant K143A/Y185A in complex with alginate tetrasaccharide [Chitinophaga sp. MD30]
6KZK_A	6.23e-10	33	293	9	240	Structure of alginate lyase Aly36B mutant K143A/M171A in complex with alginate trisaccharide [Chitinophaga sp. MD30],6KZK_B Structure of alginate lyase Aly36B mutant K143A/M171A in complex with alginate trisaccharide [Chitinophaga sp. MD30],6KZK_C Structure of alginate lyase Aly36B mutant K143A/M171A in complex with alginate trisaccharide [Chitinophaga sp. MD30]

Swiss-Prot Hits     

HMPREF1544_11555-t46_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000244	0.999738	CS pos: 23-24. Pr: 0.9805

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1544_11555-t46_1-p1.