CAZyme Information: HMPREF1544_11454-t46_1-p1

Basic Information

• Species: Mucor circinelloides
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor circinelloides
• CAZyme ID: HMPREF1544_11454-t46_1-p1
• CAZy Family: GT57
• CAZyme Description: dolichyl-diphosphooligosaccharide-protein glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
748	KE124146|CGC1	85210.03	9.2503

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mcircinelloides1006PhL	12410	1220926	183	12227

• Gene Location: location=KE124146:41796-44116(+)

Full Sequence      

MAKLDVSSQKILLKRAILGLIAVVAFSSRLFSIVRYESIIHEFDPWFNYRATRMLVKDGF
YEFWNWFDDRSWYPLGRVVGGTIYPGLMVTAAIIHNILHYFHFPVDIRNICVLLAPMFSG
LTAFATYLLTKELKDSSAGLLAAVFMGIAPGYISRSVAGSYDNEAIAIFLLMFTFYLWIK
ALKLGSALWASAAAFFYFYMVAAWGGYVFIINIIPLHVFVLMLMGRFSNRVYVSYSTFYI
LGTLMSMQIPFVGFQPTRTSEHMAALGVFGLCQIMGFVNLMRSHLQTKQFQILLKAFVGV
TFVLGFAALVGLTLGGYIAPWTGRFYSLWDTGYAKIHIPIIASVSEHQPTAWPMFFFDLQ
MLIFVFPVGIYLCFQTLRDEHVFVIVYGIFASYFAGVMVRLMLTLTPVVCICGGMAISTL
LDTYLDFSNTETAAVVAPSSSAEDEKKKKSAAKKDKKKKVFGIIANDTRIIVVGTFVFFL
FMFVWHCTWVTSNAYSSPSVVLASRNPDGSQRIIDDFREAYYWLRKNTDEDAKIMSWWDY
GYQIAGFSNRTTLVDNNTWNNTHIATVGRAMSTNEADSYEIMKKHDVNYVLVIFGGLLGY
SGDDINKFLWMIRIAQGIWPDKIKESDFFTAQGEYRVDDQASQAMKDSLMYKMSYYRFNE
VFGGRQPYDRVRNQPLPIKGPELSVLDEAFTSENWIVRIYKVKDYDNLGRDHREAMAFEA
GNKKVKAKRSKKSSERRKRAAASYDDLD

Enzyme Prediction     

EC	2.4.99.18:21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT66	14	670	1.3e-197	0.8528138528138528

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396873	STT3	1.18e-149	12	496	1	478	Oligosaccharyl transferase STT3 subunit. This family consists of the oligosaccharyl transferase STT3 subunit and related proteins. The STT3 subunit is part of the oligosaccharyl transferase (OTase) complex of proteins and is required for its activity. In eukaryotes, OTase transfers a lipid-linked core-oligosaccharide to selected asparagine residues in the ER. In the archaea STT3 occurs alone, rather than in an OTase complex, and is required for N-glycosylation of asparagines.
224206	Stt3	1.10e-103	6	710	12	737	Asparagine N-glycosylation enzyme, membrane subunit Stt3 [Posttranslational modification, protein turnover, chaperones].
275016	archaeo_STT3	5.75e-31	17	592	1	586	oligosaccharyl transferase, archaeosortase A system-associated. Members of this protein family occur, one to three members per genome, in the same species of Euryarchaeota as contain the predicted protein-sorting enzyme archaeosortase (TIGR04125) and its cognate protein-sorting signal PGF-CTERM (TIGR04126).
224720	ArnT	9.84e-05	10	195	2	171	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
404170	PMT_2	1.53e-04	113	226	26	135	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS11103.1|GT66	0.0	1	748	1	751
QRW02713.1|GT66	0.0	1	728	10	742
QRV73765.1|GT66	0.0	1	728	10	742
ATZ46879.1|GT66	0.0	13	726	22	740
CCD48580.1|GT66	0.0	13	726	22	740

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6C26_A	6.68e-311	12	714	15	694	The Cryo-EM structure of a eukaryotic oligosaccharyl transferase complex [Saccharomyces cerevisiae S288C],6EZN_F Cryo-EM structure of the yeast oligosaccharyltransferase (OST) complex [Saccharomyces cerevisiae S288C],7OCI_F Chain F, Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 [Saccharomyces cerevisiae S288C]
6S7O_A	1.92e-292	3	709	8	701	Cryo-EM structure of human oligosaccharyltransferase complex OST-A [Homo sapiens]
6S7T_A	2.92e-292	12	707	71	777	Cryo-EM structure of human oligosaccharyltransferase complex OST-B [Homo sapiens]
6FTG_5	7.76e-292	3	709	8	701	Subtomogram average of OST-containing ribosome-translocon complexes from canine rough microsomal membranes [Canis lupus familiaris],6FTI_5 Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Programmed 80S Ribosome [Canis lupus familiaris]
6FTJ_5	1.50e-289	3	704	8	696	Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Non-programmed 80S Ribosome [Canis lupus familiaris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O94335|STT3_SCHPO	6.17e-312	10	735	21	747	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit stt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=stt3 PE=3 SV=1
sp|P39007|STT3_YEAST	3.44e-310	12	714	15	694	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=STT3 PE=1 SV=2
sp|Q2KJI2|STT3A_BOVIN	9.87e-292	3	709	8	701	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Bos taurus OX=9913 GN=STT3A PE=2 SV=1
sp|P46977|STT3A_HUMAN	9.87e-292	3	709	8	701	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Homo sapiens OX=9606 GN=STT3A PE=1 SV=2
sp|Q5RCE2|STT3A_PONAB	9.87e-292	3	709	8	701	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Pongo abelii OX=9601 GN=STT3A PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000015	0.000012

TMHMM  Annotations     

Start	End
12	34
81	103
110	129
139	158
165	182
197	219
231	253
263	285
297	319
352	374
381	399
403	425
470	492