CAZyme Information: HMPREF1544_11450-t46_1-p1

Basic Information

• Species: Mucor circinelloides
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor circinelloides
• CAZyme ID: HMPREF1544_11450-t46_1-p1
• CAZy Family: GT57
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
630	KE124146|CGC1	71601.72	5.5154

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mcircinelloides1006PhL	12410	1220926	183	12227

• Gene Location: location=KE124146:30358-32369(-)

Full Sequence      

MISLRLICGVLIAQISLYSSVSAIQHHDSYTCDSPIYCEGPILKTVQLARVFADSKTFVD
MPTAKPEAQVIESFNQLGGTNATKDQVMQFLNENFLPAGTEVKLLTNITIPELSWIDSIS
DPEYRGWLSTLNKAWGNLTFEFDDSALCEECVSSTLPVSRPFVVPGGRFREFYYWDSYFV
IKGLLLGDQIDLARNMIENFFDFVQKYGFIPNGARIYYLNRSQPPFLTHMVQAFYEKTGD
DDFMTKALPILDQEYAHWMTNASIQVRDPKHSKKYTLNHYVTANTSPRPESFVEDYNTVN
NGTHFTDAEKLQMYADIAAGAESGWDYSSRWTKNKAPAANQTESYEMLRTINTASIIPIE
LNSLLWHTETKMSEWYTRFGNKTKTYKKKSKYYKSQAKARLSAMESLMWNPQNHTFYDFN
LTSNAQSTDFTPANLFPMWVGALPEKILNNRTEVAKLYDETENALRKYAGILTTSYYNTT
MQWDWPNGWPPLSYVAMEGMLRIDDYLNKEDHFKNGTVKYKGPKLNTTRGTPISTLAQVL
AERYAASAYCGWVNTGGSIPGVLEKANSSITDNGHMFEKFDVNTIGLSGGQGEYVTQTGF
GWTNGIAFWIFNQWSNFTAPDCTQVITLDL

Enzyme Prediction     

EC	3.2.1.28:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	52	612	1.4e-150	0.9918533604887984

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395961	Trehalase	2.19e-136	50	605	1	499	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
215307	PLN02567	2.99e-123	37	613	13	543	alpha,alpha-trehalase
224541	TreA	1.43e-91	34	607	53	545	Neutral trehalase [Carbohydrate transport and metabolism].
237326	treA	2.49e-87	18	606	27	528	alpha,alpha-trehalase TreA.
183936	treA	2.75e-83	153	612	142	534	alpha,alpha-trehalase TreA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS03696.1|GH37	4.30e-227	30	627	28	599
CDS07813.1|GH37	2.69e-211	32	624	33	577
VBB71529.1|GH37	1.13e-147	32	625	39	647
AEO70020.1|GH37	3.04e-147	17	625	15	640
CAP59879.1|GH37	4.47e-147	32	625	39	647

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JG0_A	5.71e-76	40	606	15	494	Family 37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]
5Z66_A	1.12e-75	34	606	46	531	Structure of periplasmic trehalase from Diamondback moth gut bacteria complexed with validoxylamine [Enterobacter cloacae],5Z6H_A Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae],5Z6H_B Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae]
2JF4_A	9.20e-72	40	606	15	494	Family 37 trehalase from Escherichia coli in complex with validoxylamine [Escherichia coli K-12]
7E9U_A	3.08e-70	54	606	40	546	Chain A, Trehalase [Arabidopsis thaliana],7E9U_B Chain B, Trehalase [Arabidopsis thaliana]
7E9X_A	4.36e-69	54	606	40	546	Chain A, Trehalase [Arabidopsis thaliana],7E9X_B Chain B, Trehalase [Arabidopsis thaliana],7E9X_C Chain C, Trehalase [Arabidopsis thaliana],7E9X_D Chain D, Trehalase [Arabidopsis thaliana],7EAW_A Chain A, Trehalase [Arabidopsis thaliana],7EAW_B Chain B, Trehalase [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54QZ5|TREA_DICDI	1.36e-133	32	622	49	594	Trehalase OS=Dictyostelium discoideum OX=44689 GN=treh PE=3 SV=1
sp|Q8MMG9|TREA_PIMHY	1.26e-107	32	621	45	578	Trehalase OS=Pimpla hypochondriaca OX=135724 GN=tre1 PE=1 SV=1
sp|Q9JLT2|TREA_MOUSE	2.97e-106	32	616	25	549	Trehalase OS=Mus musculus OX=10090 GN=Treh PE=1 SV=1
sp|P32359|TREA_TENMO	1.52e-103	31	613	24	551	Trehalase OS=Tenebrio molitor OX=7067 PE=2 SV=1
sp|P19813|TREA_RABIT	2.89e-103	32	629	28	563	Trehalase OS=Oryctolagus cuniculus OX=9986 GN=TREH PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000210	0.999799	CS pos: 23-24. Pr: 0.9725

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1544_11450-t46_1-p1.