CAZyme Information: HMPREF1544_10241-t46_1-p1

Basic Information

• Species: Mucor circinelloides
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor circinelloides
• CAZyme ID: HMPREF1544_10241-t46_1-p1
• CAZy Family: GT35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
849	KE124088|CGC1	95555.53	7.0302

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mcircinelloides1006PhL	12410	1220926	183	12227

• Gene Location: location=KE124088:44542-47557(-)

Full Sequence      

MLSDSSLTAEKVAHYLPLSGQLPEIQGRIINVTHQIPYNILRSHQHNLGQQDQYPISPPS
SPHRSDTPINATATAGKEDCTADPVAAAPISKLARHHKRGVTLRMKFHAADWTVVERRGH
QALYAGIQSLRKDNETLHIGWTGPIREQGTRNKITTDKLAVEDKVKLQSLLWETGHIVPI
FLDQKKSHGHYEGYCKQVLWPVFHYLVQTSSGDSRTEKRHWDDYVAVNRQFADTIIDRYQ
ENDIIFINDYHLLLVPEMIREKLPDAAIGIFIHATFPSSEIFRCLQTRNKILQGMLGANL
IGFQTYSYARHFISSCTRVLGCETTQVGVSYNGTMVSVGAFPIGVDCNRVAQFCKQPGVQ
PKMDAIRDMYAGKKIIVGRDKLDSTKGILQKLHAFEKFLKDFPEWRNNVVLIQVATPTHG
DHSKLEAKISEAVSHINSEFGSIAFVPCHYYHQDIDRDEYYALLSVADLALITCSRDGMN
TTSYEYVLCQHDKAEQGPLILSEFAGTAGSLSAAILVNPYDLAGVARSINDALTMSTEER
TTRHDKLYNHVTSHTADFWAHSFIKQLVSVSQQQDLQSHATPKLDMQKLIQDYKSAKKRI
MFFDYDGTLTPIVSVPSDAKPGHDMLKALQVLCNDPKNIVWVVSGRDQVVLDEWLGSNIS
NIGLSAEHGCYLKEVGSSEWKSIVDGMDMSWKADVEEIFDYYTERTQGSFVEHKKSSITW
HYRMADAEYGAFQAKECQNHLENAIVSKYPVEILVGKKNLEVRPMSVNKGEIVKRILSKN
SDTNLVMCAGDDKTDEDMFRALSAAHFQQKQISLYSITVGPSEKKTHANWHVNTPQQIIQ
VLQALAALE

Enzyme Prediction     

EC	3.1.3.12:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	108	567	7.9e-167	0.9347368421052632

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340820	GT20_TPS	0.0	111	567	18	462	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
184712	PRK14501	0.0	123	847	30	725	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
215555	PLN03063	0.0	135	846	52	784	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
395781	Glyco_transf_20	0.0	111	567	23	468	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
215556	PLN03064	0.0	132	799	132	807	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS06611.1|GT20	0.0	7	847	9	873
AJH76892.1|GT20	0.0	6	849	3	833
CDS09548.1|GT20	0.0	7	847	3	835
CDS13004.1|GT20	1.49e-308	112	846	46	776
CDS07232.1|GT20	4.01e-280	21	845	19	824

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DXF_A	4.13e-129	112	571	57	527	Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314],5DXF_B Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314]
6JBI_A	2.14e-115	123	567	30	462	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5HUT_A	8.91e-115	123	576	34	476	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]
5HUV_A	4.87e-114	123	576	34	476	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]
5HVO_A	1.15e-111	123	571	41	478	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P31688|TPS2_YEAST	3.57e-189	111	845	35	846	Trehalose-phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPS2 PE=1 SV=3
sp|P78875|TPP1_SCHPO	1.62e-187	111	846	58	813	Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tpp1 PE=1 SV=2
sp|Q54K57|TPSA_DICDI	8.19e-183	123	838	46	727	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum OX=44689 GN=tpsA PE=2 SV=1
sp|Q9P4D3|TPS2_ZYGRO	1.24e-177	111	845	30	853	Trehalose-phosphatase OS=Zygosaccharomyces rouxii OX=4956 GN=TPS2 PE=1 SV=1
sp|Q54NU9|TPSB_DICDI	9.84e-172	162	846	110	788	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] B OS=Dictyostelium discoideum OX=44689 GN=tpsB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000077	0.000000

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1544_10241-t46_1-p1.