CAZyme Information: HMPREF1544_09993-t46_1-p1

Basic Information

• Species: Mucor circinelloides
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor circinelloides
• CAZyme ID: HMPREF1544_09993-t46_1-p1
• CAZy Family: GT31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
284		33297.33	5.8189

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mcircinelloides1006PhL	12410	1220926	183	12227

• Gene Location: location=KE124078:18936-19941(-)

Full Sequence      

MRHHNYMDLNDLNSTRFGKEANEHVLVLTPLQNDEQYLDHYFELLDKTNYPNHLISIGLL
VSDSTDDTLEKLYNTVHRLQNRWRNRFYEIDVYQKDFRLDEKPNDTSLNSRRATLARAKN
FLLTAALREHHSWVAWVDVKLHSYPPTIFSDLMLVDGDVVVPNCLLKRQDDEFWGFDRNN
WQESDLSLERQQNAAEHEVLMEDYNQYSIGRHLLVDMPTHQGTRIPLDGVGTTFTLVKAT
VHREGAVFPPFVYQHELDSEGFAKMVKSMGFSVYGIPSYTIYHF

Enzyme Prediction     

No EC number prediction in HMPREF1544_09993-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT62	3	251	3.5e-63	0.9813432835820896

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397491	Anp1	4.20e-109	3	251	1	264	Anp1. The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function. These proteins co-localize within the cis Golgi, and that they are physically associated in two distinct complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS03264.1|GT62	2.58e-109	6	283	66	351
CDS03400.1|GT62	6.22e-108	6	283	44	331
CDS06706.1|GT62	1.06e-107	6	283	74	354
CDS06949.1|GT62	7.20e-106	6	283	74	359
CDS13781.1|GT62	3.33e-104	6	283	76	359

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZF8_A	7.96e-50	6	283	8	299	Crystal structure of Saccharomyces cerevisiae Mnn9 in complex with GDP and Mn. [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O74745|ANP1_SCHPO	5.88e-52	23	283	98	371	Mannan polymerase II complex anp1 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=anp1 PE=3 SV=1
sp|P39107|MNN9_YEAST	6.66e-49	6	283	98	389	Mannan polymerase complexes subunit MNN9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN9 PE=1 SV=3
sp|P32629|ANP1_YEAST	4.13e-46	6	283	64	354	Mannan polymerase II complex ANP1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ANP1 PE=1 SV=3
sp|O36022|MNN9_SCHPO	1.20e-45	8	283	51	334	Mannan polymerase complex subunit mnn9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mnn9 PE=3 SV=1
sp|P53697|MNN9_CANAL	1.03e-43	3	284	72	366	Mannan polymerase complex subunit MNN9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN9 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000083	0.000001

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1544_09993-t46_1-p1.