CAZyme Information: HMPREF1544_09594-t46_1-p1

Basic Information

• Species: Mucor circinelloides
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor circinelloides
• CAZyme ID: HMPREF1544_09594-t46_1-p1
• CAZy Family: GT22
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
498		55368.44	6.1438

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mcircinelloides1006PhL	12410	1220926	183	12227

• Gene Location: location=KE124063:76102-77651(+)

Full Sequence      

MQFSLGIVAASIALILFHSAEAAIEPQAWYTAHPGMSKIGLVDQNINQITDEHGRVRFFH
GTNVVKKSSPWYRPSTFKPGDSFGPKDVANLQALGVNAVRLGHHWAGSEPIRGQYNQTFL
DIMKQQTKLAEDHGIYVLVDVHQDVLASQLCGHGVPDWFVQRSWVPNWKQFPFPQKLIPF
SVNEKGIPSDSDCNSIDWSLSYLTTAVGNAFGRLYNNYDNLGDAFAAYWAKLAQQYVNTQ
NILGYNLLNEPWMGDTWADPTLLVPGVADHKTMEALWNRATTEIRTVDKNTLIFFEGATL
DVLSGFNDVPLGDGSRSVHSFHYYNPPQLGSISDTLKNRIKDNVRLKTAGMLTEFTFWLT
DDAGAAKLQEAVNAADEYMMSWMGWAYENLYDGNGVAHPGLAKHYSRAYPSAVAGVPTKF
AFNPSDLSFTLTFNVKKSVNAPTEIILPVPTYPNGYNVSISPSTAEIIQYKLDDRTLALF
NGESTIEGQTITVNIKRL

Enzyme Prediction     

No EC number prediction in HMPREF1544_09594-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	58	387	1.1e-132	0.9969135802469136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408348	Glyco_hydro_5_C	1.25e-20	407	493	1	86	Glycoside hydrolase family 5 C-terminal domain. This is the C-terminal domain of endo-glycoceramidase II (EGC), a membrane-associated family 5 glycosidase pfam00150. The C-terminal domain assumes a beta-sandwich fold, which resembles that of many carbohydrate-binding modules.
395098	Cellulase	1.31e-09	91	387	33	268	Cellulase (glycosyl hydrolase family 5).
396834	Glyco_hydro_42	2.08e-04	86	147	14	85	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS08592.1|GH5_27	2.31e-242	7	497	6	500
UKZ86493.1|GH5_27	2.78e-236	27	497	28	500
ATY67020.1|GH5_27	7.97e-235	14	497	10	496
QGJ01570.1|GH5_27	3.60e-234	23	495	23	497
QGI70680.1|GH5_27	3.60e-234	23	495	23	497

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5CCU_A	1.23e-27	18	460	20	446	Chain A, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S],5CCU_B Chain B, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S]
5J14_A	5.54e-27	18	460	20	446	Chain A, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S],5J14_B Chain B, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S],5J7Z_A Chain A, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S],5J7Z_B Chain B, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S]
2OSX_A	1.62e-22	49	495	37	477	Chain A, Endoglycoceramidase II [Rhodococcus sp.]
2OSW_A	2.91e-22	49	495	37	477	Endo-glycoceramidase II from Rhodococcus sp. [Rhodococcus sp.],2OSW_B Endo-glycoceramidase II from Rhodococcus sp. [Rhodococcus sp.],2OYK_A Endo-glycoceramidase II from Rhodococcus sp.: cellobiose-like isofagomine complex [Rhodococcus sp.],2OYK_B Endo-glycoceramidase II from Rhodococcus sp.: cellobiose-like isofagomine complex [Rhodococcus sp.],2OYL_A Endo-glycoceramidase II from Rhodococcus sp.: cellobiose-like imidazole complex [Rhodococcus sp.],2OYL_B Endo-glycoceramidase II from Rhodococcus sp.: cellobiose-like imidazole complex [Rhodococcus sp.],2OYM_A Endo-glycoceramidase II from Rhodococcus sp.: five-membered iminocyclitol complex [Rhodococcus sp.],2OYM_B Endo-glycoceramidase II from Rhodococcus sp.: five-membered iminocyclitol complex [Rhodococcus sp.]
6JYZ_A	1.72e-14	49	416	32	416	Chain A, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9GV16|EGCSE_CYANO	7.25e-88	42	495	34	500	Endoglycoceramidase OS=Cyanea nozakii OX=135523 PE=1 SV=1
sp|Q6L6S1|EGCSE_HYDVU	2.10e-83	42	463	25	454	Endoglycoceramidase OS=Hydra vulgaris OX=6087 PE=1 SV=1
sp|A0A3S5YBC7|EGCSE_RHOH1	1.98e-26	49	460	43	438	Endoglycoceramidase I OS=Rhodococcus hoagii (strain 103S) OX=685727 GN=REQ_38260 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000195	0.999784	CS pos: 22-23. Pr: 0.9815

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1544_09594-t46_1-p1.