CAZyme Information: HMPREF1544_09436-t46_1-p1

Basic Information

• Species: Mucor circinelloides
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor circinelloides
• CAZyme ID: HMPREF1544_09436-t46_1-p1
• CAZy Family: GT20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
432	KE124058|CGC1	50347.25	7.1571

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mcircinelloides1006PhL	12410	1220926	183	12227

• Gene Location: location=KE124058:41200-42631(-)

Full Sequence      

MKESFTLSKILRLLLSFYLAGSLFYATIHLLGFGWIQDSSSSLSSSSSLSAAANGHRQDP
VSVNQLQKKYHSLQTVTWTNAEGGQNQSIPEDLVLSKVFSDAMGPSKVIPYYFKASERFD
QEDVTISTLVTHNRFPVLSRLATRYKGPISVAIHVNDDNTKDVILRDLHAMYNDNPDMGR
YVDIHLVVDKFDRQFNMWRNVAKFFVRTDYLMMLDVDFHLCTDFRESLRKNDDLMEKLRS
GKAAIVVPAFEYILEEDGEDWRLFPKDKEALMNIVLTEKIDMFHLGWTRGHGSTDYKKWY
KSSTHYKVTDYNYSYEPYVIFKKEGSPWCDERFVGYGANKAACLYEIYLAGIDYWVLPND
FLIHQTHHYPEDTRAKERKYNKKLYDYFREEVCLRYSRLMISAGLWDTEVADNLKKECAK
IKGFREVVSRVQ

Enzyme Prediction     

No EC number prediction in HMPREF1544_09436-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT49	118	396	2.1e-45	0.827893175074184

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404735	Glyco_transf_49	1.59e-52	123	396	1	326	Glycosyl-transferase for dystroglycan. This glycosyl-transferase brings about the glycosylation of the alpha-dystroglycan subunit. Dystroglycan is an integral member of the skeletal muscular dystrophin glycoprotein complex, which links dystrophin to proteins in the extracellular matrix.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS14203.1|GT49	7.37e-223	1	431	1	427
CDS06289.1|GT49	2.20e-221	1	431	1	424
CDS06217.1|GT49	6.90e-180	51	428	53	431
CDS09884.1|GT49	1.90e-176	44	429	7	391
CDS10115.1|GT49	9.11e-172	75	429	74	427

PDB Hits     

HMPREF1544_09436-t46_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q66PG1|LARG2_DANRE	3.93e-27	113	367	457	702	Xylosyl- and glucuronyltransferase LARGE2s OS=Danio rerio OX=7955 GN=large2 PE=2 SV=1
sp|O95461|LARG1_HUMAN	7.14e-27	120	396	470	742	Xylosyl- and glucuronyltransferase LARGE1 OS=Homo sapiens OX=9606 GN=LARGE1 PE=1 SV=1
sp|Q66PG2|LARG1_DANRE	7.15e-27	112	413	463	756	Xylosyl- and glucuronyltransferase LARGE1 OS=Danio rerio OX=7955 GN=large1 PE=2 SV=1
sp|Q9Z1M7|LARG1_MOUSE	9.60e-27	111	396	463	742	Xylosyl- and glucuronyltransferase LARGE1 OS=Mus musculus OX=10090 GN=Large1 PE=1 SV=1
sp|Q66PG3|LARG1_CHICK	3.13e-26	120	367	470	708	Xylosyl- and glucuronyltransferase LARGE1 OS=Gallus gallus OX=9031 GN=LARGE1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000029	0.000001

TMHMM  Annotations     

Start	End
13	35