CAZyme Information: HMPREF1544_09176-t46_1-p1

Basic Information

• Species: Mucor circinelloides
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor circinelloides
• CAZyme ID: HMPREF1544_09176-t46_1-p1
• CAZy Family: GT20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
290	KE124050|CGC1	31964.63	6.9059

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mcircinelloides1006PhL	12410	1220926	183	12227

• Gene Location: location=KE124050:16157-17090(+)

Full Sequence      

MLKFLILILLSILSTAAAQNYFYGLNYGINQNACPSYETIKAEFAQIKKYTNRVRTFSLS
VCNEGALALRAANELGMNIYLGMWIDRPDTFDAEMAALKAILANTQQESLSKVDAVIVGS
EVLYRKDTDENSLANYIGTVRNLLKPKGIAVTTADVYYEFPPVVVEKLDFLLMNAFPYWE
GVTAAQGASTLMAHYDSVVQQKANGKPVRIGETGWPSGGGNFGASVASSANQKLYLSNVL
CVTRQRNIDMLYFSARDEPYKAGVEAYWGVMYSNFTLKSNLPTTLLANPC

Enzyme Prediction     

EC	3.2.1.-:2	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	24	278	7.9e-32	0.977491961414791

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	8.26e-58	16	274	39	304	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	8.73e-14	24	281	2	307	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJO29715.1|GH17|2.4.1.-	1.14e-112	22	281	3	258
CDS07285.1|GH17	9.57e-97	15	281	17	278
CDS06589.1|GH17	7.64e-62	67	273	8	211
AIG56146.1|GH17	4.11e-41	8	278	7	292
AIG55438.1|GH17	5.81e-41	1	288	1	313

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	1.26e-113	22	281	37	292	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	1.02e-112	22	281	37	292	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O13990|BGL2_SCHPO	7.45e-35	14	284	37	319	Glucan 1,3-beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bgl2 PE=2 SV=4
sp|P15703|BGL2_YEAST	2.02e-30	26	281	30	308	Glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BGL2 PE=1 SV=1
sp|D4B2W4|BGL2_ARTBC	3.66e-29	17	280	20	298	Glucan 1,3-beta-glucosidase ARB_02797 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02797 PE=1 SV=1
sp|P43070|BGL2_CANAX	3.79e-27	3	281	4	303	Glucan 1,3-beta-glucosidase OS=Candida albicans OX=5476 GN=BGL2 PE=3 SV=1
sp|Q5AMT2|BGL2_CANAL	1.02e-26	3	281	4	303	Glucan 1,3-beta-glucosidase BGL2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BGL2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000220	0.999730	CS pos: 18-19. Pr: 0.9713

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1544_09176-t46_1-p1.