CAZyme Information: HMPREF1544_09054-t46_1-p1

Basic Information

• Species: Mucor circinelloides
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor circinelloides
• CAZyme ID: HMPREF1544_09054-t46_1-p1
• CAZy Family: GT2
• CAZyme Description: starch phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
889	KE124046|CGC1	101043.93	6.1133

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mcircinelloides1006PhL	12410	1220926	183	12227

• Gene Location: location=KE124046:81105-83774(-)

Full Sequence      

MSTTPTSERPRRLSMPKLTRRLTNVTIHVDDDKDNLEPVTTSSVPSSKSKHIALDPEHLK
EWKQEMTPKKNDKASIKKDIVLHSVETLCRSPYNLDKLAVYQATAYSVRDRLLEDWNMTQ
EAVHKENPKRCYYLSMEFLIGRALDNALHCLEVKDVYKDSVKDLGFNLEDLLQQERDAAL
GNGGLGRLAACYMDAAATLDYPTWGYGLRYQYGIFKQLINSDGYQIEMPDYWLDSNGNPW
EFPRNDVRYEVQFYGYVATKVNEKGESRMSWEGGDRVQAMAYDVPIPGFDTKGCGNIRLW
ASKSLKTFDFASFNDGDYDRSVADQKNAENLTSVLYPNDNHLVGKELRLKQEYFFVSASL
QDIIHRFKRSNCAWKDFPDKVAVQLNDTHPTLAIPELQRILVDIEGLDWDAAWDIVTRVF
AFTNHTVLPEALECWSVPMMEHILPRHMQIVYDINLFFLQKVEKMNSDRGLLNRVSIIEE
SNPQQVRMAYLAVVGSHTVNGVAALHSDLVKTELFKDFVSYYGPEKFINITNGITPRRWL
YQANPDLRDLITETLGNKHWVTHLDDLKGLKKYADDADFQAKWMNIKLKNKVRLASWIKA
NLGITVDPRSLFDIQVKRIHEYKRQFMNILGVIYRYKNLQLLSAEERKEVTPRVVIFGGK
SAPGYYVAKMVIKLINTVAQVVNNDDSIDGLLKVVYIPDYNVSLAEIIVPASDISQHIST
AGTEAAGTSNMKFVLNGGLILGTVDGANIEIRDEIGAENIFMFGTLADKVADIRHQQRYH
GVEIDPNLQVVLQSIQSGEFGGPETASVFGPLINTLTYGGDYYLISADFEKYLDAQDKVD
ETYKDTAAWAKKSILCTAGMGFFSSDRATREYADKIWNLKPVNIKESAV

Enzyme Prediction     

EC	2.4.1.1:158

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT35	161	879	9.4e-275	0.9955489614243324

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
184948	PRK14986	0.0	103	884	44	815	glycogen phosphorylase; Provisional
223136	GlgP	0.0	90	881	23	750	Glucan phosphorylase [Carbohydrate transport and metabolism].
237881	PRK14985	0.0	112	880	42	797	maltodextrin phosphorylase; Provisional
273967	P_ylase	0.0	83	879	4	794	glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
340853	GT35_Glycogen_Phosphorylase	0.0	77	879	1	795	glycogen phosphorylase and similar proteins. This is a family of oligosaccharide phosphorylases. It includes yeast and mammalian glycogen phosphorylases, plant starch/glucan phosphorylase, as well as the maltodextrin phosphorylases of bacteria. The members of this family catalyze the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism. The allosteric control mechanisms of yeast and mammalian members of this family are different from that of bacterial members. The members of this family belong to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EGX46445.1|GT35	0.0	56	884	48	873
QKD52993.1|GT35	0.0	45	886	48	886
QNQ01362.1|GT35	0.0	62	886	69	888
AOW06640.1|GT35	0.0	62	886	69	888
CAG77789.1|GT35	0.0	62	886	69	888

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1YGP_A	0.0	16	882	1	878	Phosphorylated Form Of Yeast Glycogen Phosphorylase With Phosphate Bound In The Active Site. [Saccharomyces cerevisiae],1YGP_B Phosphorylated Form Of Yeast Glycogen Phosphorylase With Phosphate Bound In The Active Site. [Saccharomyces cerevisiae]
4BQE_A	4.11e-285	68	880	55	869	Arabidopsis thaliana Cytosolic Alpha-1,4-glucan Phosphorylase (PHS2) [Arabidopsis thaliana],4BQE_B Arabidopsis thaliana Cytosolic Alpha-1,4-glucan Phosphorylase (PHS2) [Arabidopsis thaliana],4BQF_A Arabidopsis thaliana cytosolic alpha-1,4-glucan phosphorylase (PHS2) in complex with acarbose [Arabidopsis thaliana],4BQF_B Arabidopsis thaliana cytosolic alpha-1,4-glucan phosphorylase (PHS2) in complex with acarbose [Arabidopsis thaliana],4BQI_A ARABIDOPSIS THALIANA cytosolic alpha-1,4-glucan phosphorylase (PHS2) in complex with maltotriose [Arabidopsis thaliana],4BQI_B ARABIDOPSIS THALIANA cytosolic alpha-1,4-glucan phosphorylase (PHS2) in complex with maltotriose [Arabidopsis thaliana]
5LR8_A	1.40e-267	72	882	28	923	Structure of plastidial phosphorylase Pho1 from Barley [Hordeum vulgare subsp. vulgare],5LR8_B Structure of plastidial phosphorylase Pho1 from Barley [Hordeum vulgare subsp. vulgare],5LRA_A Plastidial phosphorylase PhoI from barley in complex with maltotetraose [Hordeum vulgare subsp. vulgare],5LRA_B Plastidial phosphorylase PhoI from barley in complex with maltotetraose [Hordeum vulgare subsp. vulgare],5LRB_A Plastidial phosphorylase from Barley in complex with acarbose [Hordeum vulgare subsp. vulgare],5LRB_B Plastidial phosphorylase from Barley in complex with acarbose [Hordeum vulgare subsp. vulgare]
1FC0_A	9.35e-250	74	887	25	835	HUMAN LIVER GLYCOGEN PHOSPHORYLASE COMPLEXED WITH N-ACETYL-BETA-D-GLUCOPYRANOSYLAMINE [Homo sapiens],1FC0_B HUMAN LIVER GLYCOGEN PHOSPHORYLASE COMPLEXED WITH N-ACETYL-BETA-D-GLUCOPYRANOSYLAMINE [Homo sapiens],2ATI_A Glycogen Phosphorylase Inhibitors [Homo sapiens],2ATI_B Glycogen Phosphorylase Inhibitors [Homo sapiens]
1FA9_A	9.35e-250	74	887	25	835	HUMAN LIVER GLYCOGEN PHOSPHORYLASE A COMPLEXED WITH AMP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P06738|PHSG_YEAST	0.0	15	882	23	901	Glycogen phosphorylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPH1 PE=1 SV=4
sp|Q00766|PHS1_DICDI	0.0	40	885	14	846	Glycogen phosphorylase 1 OS=Dictyostelium discoideum OX=44689 GN=glpV PE=1 SV=3
sp|P34114|PHS2_DICDI	1.68e-295	72	880	110	908	Glycogen phosphorylase 2 OS=Dictyostelium discoideum OX=44689 GN=glpD PE=1 SV=2
sp|Q9SD76|PHS2_ARATH	6.84e-285	68	880	22	836	Alpha-glucan phosphorylase 2, cytosolic OS=Arabidopsis thaliana OX=3702 GN=PHS2 PE=1 SV=1
sp|P53537|PHSH_VICFA	7.08e-285	76	884	33	841	Alpha-glucan phosphorylase, H isozyme OS=Vicia faba OX=3906 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000056	0.000000

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1544_09054-t46_1-p1.