CAZyme Information: HMPREF1544_08975-t46_1-p1

Basic Information

• Species: Mucor circinelloides
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor circinelloides
• CAZyme ID: HMPREF1544_08975-t46_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
547		61588.49	6.9853

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mcircinelloides1006PhL	12410	1220926	183	12227

• Gene Location: location=KE124044:38153-39925(-)

Full Sequence      

MKLLLSLALLVSSCNLASCSPNQQVSESLQSFRQPKNIAFCVSGGGSSHIEWVLSIMEEL
SNRGHITTFLTRDSHKKFGKKFPVVETVSLGDDSEYLNAFKEFTVNNRHSTLASLSTTLL
KAIKPTFEEDYLKTLELFKSRKIDVALCDHFTTSCQEACHTLRIPFLVTSSIAAAPDTEA
PYIDCDDLYMRHLSNLEKSFFERVYDKLIVPVKVFLNTFKLVQEQKRRHLALGIKDPVFP
HEERWKDSIKLFNTAFGFESARPLGPLVELIGPIIPKSAASVLPEDMDQFLKTHQRVAYI
AFGQHAVTNESELTLLLAGLLEAYEKGDIDGMIWSTRGLDGILPSVVTTRSNTTYDIHPH
LHQDKFGDFAFLQWAPQTAILQHPSTTVFVTHAGAGSLYEGLQAGKRLVLYPFFADQPRN
SHLAEKFGLGLRVDYKGTRDEAAQIIQRVARDVDGFFQSNVNRFQALVQIRSQTGITNGA
NLVEEVAFMHQDTVLHHRRDVKHDLSFIVAHNLDVYMFGLVTICLPLFVGIYTLNSFFSR
DEKVKTQ

Enzyme Prediction     

No EC number prediction in HMPREF1544_08975-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	283	443	6.8e-23	0.3743455497382199

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	4.26e-33	37	474	2	395	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
278624	UDPGT	4.35e-18	48	520	11	471	UDP-glucoronosyl and UDP-glucosyl transferase.
224732	YjiC	1.23e-11	38	487	4	399	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
273616	MGT	1.93e-10	373	484	281	387	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
215127	PLN02210	1.62e-09	365	433	322	391	UDP-glucosyl transferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOC55050.1|GT1	5.05e-151	32	547	34	543
AOC55049.1|GT1	1.65e-101	35	516	33	511
CDS06891.1|GT1	4.77e-93	35	547	45	551
CDS06902.1|GT1	7.13e-91	35	547	39	547
CDS11218.1|GT1	1.38e-86	36	547	42	545

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JTD_A	3.33e-11	271	460	248	446	Crystal structure of TcCGT1 in complex with UDP [Trollius chinensis],6JTD_B Crystal structure of TcCGT1 in complex with UDP [Trollius chinensis]
2VCE_A	1.78e-10	263	455	238	432	Characterization and engineering of the bifunctional N- and O- glucosyltransferase involved in xenobiotic metabolism in plants [Arabidopsis thaliana],2VCH_A Characterization and engineering of the bifunctional N- and O- glucosyltransferase involved in xenobiotic metabolism in plants [Arabidopsis thaliana],2VG8_A Characterization and engineering of the bifunctional N- and O- glucosyltransferase involved in xenobiotic metabolism in plants [Arabidopsis thaliana]
2PQ6_A	1.79e-10	199	449	214	436	Crystal structure of Medicago truncatula UGT85H2- Insights into the structural basis of a multifunctional (Iso) flavonoid glycosyltransferase [Medicago truncatula]
7Q3S_A	2.40e-10	266	437	243	417	Chain A, Glycosyltransferase [Zea mays]
6IJ7_A	4.66e-09	271	452	207	397	Crystal Structure of Arabidopsis thaliana UGT89C1 [Arabidopsis thaliana],6IJ7_B Crystal Structure of Arabidopsis thaliana UGT89C1 [Arabidopsis thaliana],6IJ9_A Crystal Structure of Arabidopsis thaliana UGT89C1 complexed with UDP [Arabidopsis thaliana],6IJ9_B Crystal Structure of Arabidopsis thaliana UGT89C1 complexed with UDP [Arabidopsis thaliana],6IJ9_C Crystal Structure of Arabidopsis thaliana UGT89C1 complexed with UDP [Arabidopsis thaliana],6IJ9_D Crystal Structure of Arabidopsis thaliana UGT89C1 complexed with UDP [Arabidopsis thaliana],6IJA_A Crystal Structure of Arabidopsis thaliana UGT89C1 complexed with UDP-L-rhamnose [Arabidopsis thaliana],6IJA_B Crystal Structure of Arabidopsis thaliana UGT89C1 complexed with UDP-L-rhamnose [Arabidopsis thaliana],6IJA_C Crystal Structure of Arabidopsis thaliana UGT89C1 complexed with UDP-L-rhamnose [Arabidopsis thaliana],6IJA_D Crystal Structure of Arabidopsis thaliana UGT89C1 complexed with UDP-L-rhamnose [Arabidopsis thaliana],6IJD_A Crystal Structure of Arabidopsis thaliana UGT89C1 complexed with quercetin [Arabidopsis thaliana],6IJD_B Crystal Structure of Arabidopsis thaliana UGT89C1 complexed with quercetin [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O75795|UDB17_HUMAN	1.11e-17	48	529	34	508	UDP-glucuronosyltransferase 2B17 OS=Homo sapiens OX=9606 GN=UGT2B17 PE=1 SV=1
sp|P16662|UD2B7_HUMAN	1.95e-17	38	529	14	507	UDP-glucuronosyltransferase 2B7 OS=Homo sapiens OX=9606 GN=UGT2B7 PE=1 SV=2
sp|P36510|UD2A1_RAT	2.57e-17	197	515	203	491	UDP-glucuronosyltransferase 2A1 OS=Rattus norvegicus OX=10116 GN=Ugt2a1 PE=2 SV=1
sp|P06133|UD2B4_HUMAN	6.06e-17	48	529	34	507	UDP-glucuronosyltransferase 2B4 OS=Homo sapiens OX=9606 GN=UGT2B4 PE=1 SV=2
sp|Q9GLD9|UDB33_MACMU	1.07e-16	190	529	198	507	UDP-glucuronosyltransferase 2B33 OS=Macaca mulatta OX=9544 GN=UGT2B33 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001531	0.998438	CS pos: 19-20. Pr: 0.8416

TMHMM  Annotations     

Start	End
516	538