CAZyme Information: HMPREF1544_08532-t46_1-p1

Basic Information

• Species: Mucor circinelloides
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor circinelloides
• CAZyme ID: HMPREF1544_08532-t46_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
409		46399.68	9.2433

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mcircinelloides1006PhL	12410	1220926	183	12227

• Gene Location: location=KE124031:84802-86262(-)

Full Sequence      

MLKQVYSIAITSRLITIGLAIATYFFTGSYDSSGEIQLDTTAKCALNVFLRWDALYFLHI
AEKGYVYEQETAFFPVMPLLAKLLANTVFLPLQRLLGNRYTLLLAGVAVANVSFVLAAGA
LYKLTLAVLPKNKQLAYVSSIAFCLSPPAMFMSSFYTESIFALMTFTGMRWIIEKKYTQS
ALIWGIASGVRSNAVVYAGFFFYDLVWTRLINRKVSMLKIRSVLYTLITASGFALFQYYA
YTEFCSLDRPWCSDKVPLIYSFVQKEYWDVGFLSYYEVKQIPNFVLAAPIIALSVFGLKA
YIQQDPVGFWTLGIRKSKQDGNDDYCSPNLAVFMYLWAFLLLFATTNMHIQVIIRFFTSV
PPLYWYVGNLWIKGFCESKSTWMANVVLGYFAIYGLIGIVLFSSFLPPA

Enzyme Prediction     

No EC number prediction in HMPREF1544_08532-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	9	409	3.9e-106	0.9877149877149877

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	1.95e-64	3	409	2	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	3.28e-20	51	366	76	362	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS09540.1|GT76	1.09e-137	2	409	4	392
BBN03197.1|GT76	1.58e-73	3	407	13	480
AFE66668.1|GT76	1.49e-64	3	407	9	491
AFI33569.1|GT76	1.49e-64	3	407	9	491
AFH29443.1|GT76	1.49e-64	3	407	9	491

PDB Hits     

HMPREF1544_08532-t46_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9NUD9|PIGV_HUMAN	4.23e-63	3	407	9	491	GPI mannosyltransferase 2 OS=Homo sapiens OX=9606 GN=PIGV PE=1 SV=1
sp|Q7TPN3|PIGV_MOUSE	1.93e-59	3	407	9	491	GPI mannosyltransferase 2 OS=Mus musculus OX=10090 GN=Pigv PE=2 SV=2
sp|Q5KR61|PIGV_RAT	1.50e-57	3	370	9	420	GPI mannosyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Pigv PE=2 SV=1
sp|Q4WQ21|GPI18_ASPFU	2.98e-45	49	409	84	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1
sp|Q4I0K3|GPI18_GIBZE	5.63e-45	51	409	64	423	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.985072	0.014942

TMHMM  Annotations     

Start	End
5	27
100	122
135	157
181	203
223	241
280	302
325	347
352	371
384	406