CAZyme Information: HMPREF1544_08524-t46_1-p1

Basic Information

• Species: Mucor circinelloides
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor circinelloides
• CAZyme ID: HMPREF1544_08524-t46_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
557		64022.35	8.8090

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mcircinelloides1006PhL	12410	1220926	183	12227

• Gene Location: location=KE124031:57644-59637(+)

Full Sequence      

MVSGTSTFTHGEATEVLVYSLKQTNTKHDIVVLVLDDVTQTVRSRLEYLGAKIINVDQIK
YPWDSSSARRKGFNKACRYSKLNLWNLTQYEKVVFLDADTMVVNNIDELFGYPQFTAAVD
IGGVLNTGVFVAEPNAETYKDIMATYEKAPSYNKGDQGFLNYYFNKTANPLPGNYNLMIK
FTHFSTLASEFVTKNTVKVLHFTSETKPWNFHFLHQREWRENYDGYLFGLWTRSLRNMRS
QLEEGGLWTSTDNWENKGRVSNICDHRLKSNYGRKYPKNNQFTVIVTLNKPSINKQYLEQ
MLRMYASSKRVHQIFINGNSIRDQHGNRFSLNQAYLRSLKLRKPVKAIARGPYNTVNWKF
NPIQGITTDAVFLADENIITSLEDLEFAYDLWKKNMDSIVGFKSDAHSLQTATDSYTFVE
NLDNDNRYSMIRNNMFLKSDFLYGYTCIMPEEIHQYIDKYPACRDIAINMLVSGQTGSSP
LLVKADYVFEFEDSHSQTIRQRSQCINDLSVLFNGKNTLNLNNEIVSKVSPDQVSTPTSW
DTWASSIAAIKAKKNPA

Enzyme Prediction     

EC	2.4.1.186:40	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT64	282	515	8.9e-41	0.9354838709677419
GT8	13	211	1.2e-39	0.8249027237354085

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133018	GT8_Glycogenin	8.12e-57	16	231	18	233	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
401264	Glyco_transf_64	1.59e-33	282	513	1	227	Glycosyl transferase family 64 domain. Members of this family catalyze the transfer reaction of N-acetylglucosamine and N-acetylgalactosamine from the respective UDP-sugars to the non-reducing end of [glucuronic acid]beta 1-3[galactose]beta 1-O-naphthalenemethanol, an acceptor substrate analog of the natural common linker of various glycosylaminoglycans. They are also required for the biosynthesis of heparan-sulphate.
215090	PLN00176	1.85e-24	17	211	42	268	galactinol synthase
132996	Glyco_transf_8	3.77e-20	2	210	4	245	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
279798	Glyco_transf_8	5.00e-19	13	210	13	249	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAM79674.1|GT64|GT8	7.43e-66	13	528	173	719
CDS12929.1|GT64	1.71e-30	186	483	105	382
AAA31404.1|GT8|2.4.1.186	1.39e-27	16	213	21	224
CCG00969.1|GT8	3.77e-27	20	214	23	223
ACM81895.1|GT8|2.4.1.186	6.22e-27	16	266	18	282

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3USR_A	8.09e-30	16	213	41	244	Structure of Y194F glycogenin mutant truncated at residue 270 [Oryctolagus cuniculus]
3USQ_A	8.09e-30	16	213	41	244	Structure of D159S/Y194F glycogenin mutant truncated at residue 270 [Oryctolagus cuniculus]
1ZCV_A	1.46e-29	16	213	41	244	Chain A, Glycogenin-1 [Oryctolagus cuniculus]
1ZCT_A	2.03e-29	16	213	41	244	structure of glycogenin truncated at residue 270 in a complex with UDP [Oryctolagus cuniculus],1ZCT_B structure of glycogenin truncated at residue 270 in a complex with UDP [Oryctolagus cuniculus]
3V90_A	2.07e-29	16	213	41	244	Structure of T82M glycogenin mutant truncated at residue 270 [Oryctolagus cuniculus],3V91_A Structure of T82M glycogenin mutant truncated at residue 270 complexed with UDP-glucose [Oryctolagus cuniculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P13280|GLYG_RABIT	2.47e-28	16	213	21	224	Glycogenin-1 OS=Oryctolagus cuniculus OX=9986 GN=GYG1 PE=1 SV=3
sp|Q9R062|GLYG_MOUSE	7.47e-27	16	213	21	224	Glycogenin-1 OS=Mus musculus OX=10090 GN=Gyg1 PE=1 SV=3
sp|O08730|GLYG_RAT	7.47e-27	16	213	21	224	Glycogenin-1 OS=Rattus norvegicus OX=10116 GN=Gyg1 PE=2 SV=4
sp|P46976|GLYG_HUMAN	1.37e-26	16	213	21	224	Glycogenin-1 OS=Homo sapiens OX=9606 GN=GYG1 PE=1 SV=4
sp|F4HZC3|GUX5_ARATH	1.03e-24	17	164	297	439	Putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 5 OS=Arabidopsis thaliana OX=3702 GN=GUX5 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000043	0.000000

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1544_08524-t46_1-p1.