CAZyme Information: HMPREF1544_08464-t46_1-p1

Basic Information

• Species: Mucor circinelloides
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor circinelloides
• CAZyme ID: HMPREF1544_08464-t46_1-p1
• CAZy Family: GT2
• CAZyme Description: alpha

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
764	KE124030|CGC1	88532.47	5.7760

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mcircinelloides1006PhL	12410	1220926	183	12227

• Gene Location: location=KE124030:11368-13860(-)

Full Sequence      

MVTLPTFDHDIKHDAHAPASTYYTTGDNARQRTRTYTRSHLDLQANGNNLEGTRRRRASH
DDKNKARRFLIDVEETQRKILEQEDTDGDFQITINDLGPKTMSLGTADSGGYRKIDIRGT
YMLSNLLQELALANDYGRKHIVLDEARLNENPVDRLSRMIKFNFWDGLTRRIDSDSLEVI
CPDPKNRSSNKNPRIYVPYNDKEAYEFYKQVSQVRKHLNLEVEYLPEKITAEYTKSINDR
PGLLTLAMRKTKDDQGNDTYVGEPFVVPGGRFNEMYGWDSYFSALGLLEDGRIELARSMV
ENFAYQIKHYGKILNANRSYYLSRSQPPFLTDMTLKVFERLHPQDEEENKVWLRRILKSA
IKEYWEVWMSEPRLDKKTMLSRYRPDGSGIPPETEASHFVHIIEPFAEKHNLTVDEFNQQ
YNDGVIKEPELDEYFLHDRAVRESGHDTTYRFEKICANLATIDLNSLLYKYEMDIADAIV
DYLDDDLEDFNGVKQKAEDWLERAKQRRERIDKYLWNEKESLYFDYDTVKEEQITYESVT
SFWALWAGCASDHQAQEMVKHSLSKFEVMGGLVSGTEESRGVTSLERPNRQWDFPFGWSP
HQMLTWVGLDKYGMRDTAARLAYRWLFTITKGFVDFNGVVPEKFDVVSLSHKVEVEYGNV
GTDFKCVPREGFGWMNASYQVGLSYLTTQMRRALGTCTLPDLLFEKAMIREHRMLGLTPE
EEEAAMLRRRTSTLAARAITRNGSISAAVTRISLSDGPSNATSF

Enzyme Prediction     

EC	3.2.1.28:32

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	136	684	6.8e-151	0.9918533604887984

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224541	TreA	0.0	66	692	7	558	Neutral trehalase [Carbohydrate transport and metabolism].
395961	Trehalase	0.0	135	686	2	508	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
215307	PLN02567	1.00e-54	263	686	141	541	alpha,alpha-trehalase
183936	treA	1.10e-53	264	676	150	526	alpha,alpha-trehalase TreA.
183934	treF	3.16e-52	263	676	160	536	alpha,alpha-trehalase TreF.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS12450.1|GH37	0.0	14	752	15	749
CDS14080.1|GH37	0.0	6	763	8	757
CDS07923.1|GH37	0.0	14	752	14	738
AAX19735.1|GH37	0.0	10	707	3	700
AAX19736.1|GH37	0.0	10	710	3	705

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JTA_A	4.62e-269	56	717	80	751	Neutral trehalase Nth1 from Saccharomyces cerevisiae [Saccharomyces cerevisiae]
5NIS_A	1.53e-268	72	717	6	656	Neutral trehalase Nth1 from Saccharomyces cerevisiae [Saccharomyces cerevisiae S288C]
5N6N_C	2.22e-268	67	717	100	756	CRYSTAL STRUCTURE OF THE 14-3-3:NEUTRAL TREHALASE NTH1 COMPLEX [Saccharomyces cerevisiae S288C]
5M4A_A	2.81e-245	122	717	3	603	Neutral trehalase Nth1 from Saccharomyces cerevisiae in complex with trehalose [Saccharomyces cerevisiae]
2JG0_A	6.59e-42	242	676	91	492	Family 37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O42893|TREA_SCHPO	3.65e-286	55	704	67	716	Cytosolic neutral trehalase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ntp1 PE=1 SV=1
sp|O42783|TREB_NEUCR	6.64e-284	12	718	19	741	Cytosolic neutral trehalase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=treB PE=2 SV=2
sp|O42622|TREB_MAGO7	1.87e-271	8	708	15	724	Cytosolic neutral trehalase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=NTH1 PE=2 SV=2
sp|A0A384JRP0|TREA_BOTFB	7.82e-271	14	708	18	725	Cytosolic neutral trehalase OS=Botryotinia fuckeliana (strain B05.10) OX=332648 GN=TRE1 PE=3 SV=1
sp|O42777|TREB_EMENI	3.63e-270	67	708	87	737	Cytosolic neutral trehalase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=treB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999657	0.000356

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1544_08464-t46_1-p1.