CAZyme Information: HMPREF1544_08327-t46_1-p1

Basic Information

• Species: Mucor circinelloides
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor circinelloides
• CAZyme ID: HMPREF1544_08327-t46_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
771	KE124026|CGC1	86817.67	6.7598

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mcircinelloides1006PhL	12410	1220926	183	12227

• Gene Location: location=KE124026:24867-27637(+)

Full Sequence      

MWNSVMKSVGLLPTEEYIQPRLSIGNAVSDHEFSTGHFKIKVDAQALCLTIKNVHNRIIW
KSLHNLPFLSTCLGKDSVSPGDNGVFKITECSEKPSRLQTITKIQKENDTTIHIYGGLSA
KLVAPTHMDYVMTFKEVSHRQLQFSVQVTHRDPCMEDYDRLILTYESRAEENFYGFGEQF
SYASVKGQKVPILVREQGAGRGAPAVKSALSMLGSYGSADNFATYASVPQYISSDIRCLF
MENSEYMSFDMTEPDRVSIRLESDKMRGRILDGKTMLDLITEYTSYAGRMLPLPDWVSAG
VIAGIHGGKEKTKQIIQQLRQKDIPIAAVFLPDWTGERLQETGRDVRFTRSWWNWESDDD
LYPEWDAFVQSLANDEGGRIRVLSYVNPLLTATNLKPRFKKNLFAVAQEKGYLVKSTQSS
SSDSQALSIKFGLNLEAGILDLTHPEARTWFKEIMKEQVWKSGISGLMADFGEHLPCDSG
KITLHSGETASTYHNHYPEEWAQLHQEVVMELGKEDEAVCFFRSGYTHSPGHMNLFWAGD
QTVTWDAHYGIKSAVIGMLSGGFSGFSVTHCDAGGYNTVPSSIPGMRMTRTKELLFRWLE
LAVFTAAFRTSEGIIPSLNAQFYDDEDSLAHLAHTVKLFTTIAAYKKTVLKEAYDKGWPL
LRHPVLYYPNDKIARELTYQQFMVGSSMMVAPVLTPSTAFVKVYFPKDAQKVTWRHVWSG
KYYAGDGTYQAIDAPLGQPALFIKEPRGDDGLLNGLLDYATTYYQQKTQPK

Enzyme Prediction     

No EC number prediction in HMPREF1544_08327-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	271	745	4.9e-74	0.9812646370023419

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
236691	PRK10426	0.0	144	758	55	632	alpha-glucosidase; Provisional
269880	GH31_glucosidase_YihQ	1.40e-173	288	636	1	325	alpha-glucosidase YihQ-like. YihQ is a bacterial alpha-glucosidase with a conserved glycosyl hydrolase family 31 (GH31) domain that catalyzes the release of an alpha-glucosyl residue from the non-reducing end of alpha-glucoside substrates such as alpha-glucosyl fluoride. Orthologs of YihQ that have not yet been functionally characterized are present in plants and fungi. YihQ has sequence similarity to other GH31 enzymes such as CtsZ, a 6-alpha-glucosyltransferase from Bacillus globisporus, and YicI, an alpha-xylosidase from Echerichia coli. These latter two belong to different GH31 subfamilies than YihQ. In bacteria, YihQ (along with YihO) is important for bacterial O-antigen capsule assembly and translocation.
224418	YicI	1.47e-75	161	765	143	690	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
395838	Glyco_hydro_31	2.36e-49	270	745	2	438	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
269878	GH31_NET37	6.13e-35	354	707	49	361	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS13477.1|GH31	2.44e-309	1	763	1	761
QIN82013.1|GH31	6.14e-178	99	745	108	722
USW53386.1|GH31	9.43e-163	59	743	57	741
BCS07610.1|GH31	2.08e-161	56	745	48	744
BCR95040.1|GH31	2.08e-161	56	745	48	744

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6PNR_A	2.51e-104	170	745	111	650	Chain A, Alpha-glucosidase [[Eubacterium] rectale],6PNR_C Chain C, Alpha-glucosidase [[Eubacterium] rectale]
5AED_A	1.03e-100	157	744	113	663	A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AED_B A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AEG_A A bacterial protein structure in glycoside hydrolase family 31. [Escherichia coli K-12],5AEG_B A bacterial protein structure in glycoside hydrolase family 31. [Escherichia coli K-12],5OHT_A A GH31 family sulfoquinovosidase from E. coli in complex with aza-sugar inhibitor IFGSQ [Escherichia coli K-12],5OHT_B A GH31 family sulfoquinovosidase from E. coli in complex with aza-sugar inhibitor IFGSQ [Escherichia coli K-12]
5AEE_A	5.52e-100	157	744	113	663	A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AEE_B A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12]
5OHY_A	3.05e-88	156	744	95	648	Chain A, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHY_B Chain B, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHY_C Chain C, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHY_D Chain D, Alpha-glucosidase yihQ [Agrobacterium tumefaciens]
5OHS_A	1.60e-87	156	744	95	648	Chain A, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_B Chain B, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_C Chain C, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_D Chain D, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_E Chain E, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_F Chain F, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_G Chain G, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_H Chain H, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_A Chain A, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_B Chain B, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_C Chain C, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_D Chain D, Alpha-glucosidase yihQ [Agrobacterium tumefaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32138|SQASE_ECOLI	4.34e-100	157	744	113	663	Sulfoquinovosidase OS=Escherichia coli (strain K12) OX=83333 GN=yihQ PE=1 SV=3
sp|Q9F234|AGL2_BACTQ	8.85e-23	171	745	147	670	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
sp|Q69ZQ1|MYORG_MOUSE	1.44e-13	439	706	431	680	Myogenesis-regulating glycosidase OS=Mus musculus OX=10090 GN=Myorg PE=1 SV=2
sp|Q6NSJ0|MYORG_HUMAN	2.50e-13	439	706	432	678	Myogenesis-regulating glycosidase OS=Homo sapiens OX=9606 GN=MYORG PE=1 SV=2
sp|A2QTU5|XYLA_ASPNC	4.44e-13	441	736	384	716	Alpha-xylosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=axlA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000063	0.000009

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1544_08327-t46_1-p1.