CAZyme Information: HMPREF1544_08255-t46_1-p1

Basic Information

• Species: Mucor circinelloides
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor circinelloides
• CAZyme ID: HMPREF1544_08255-t46_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
754		84244.33	7.4480

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mcircinelloides1006PhL	12410	1220926	183	12227

• Gene Location: location=KE124024:58114-60650(+)

Full Sequence      

MKLSVSIVLTVGLLLYPHQAQATASSMKKSNHLLEPIDASIPPPPSVFPSIQHPFSPIYA
DPKFKAVVPTSSWISNLFYPSVNNLAPTTPDPYILRLLDDFGGNPGLSISQPHDKVIGSY
PAMNNIPPSPAGYIINGVVVDIRLTAQEWTKAPSPLVTNWGHFNAHLRLSGGNGKVEFPL
VRGQSFITAAYTGLTPQFFTQHAIISVAADQANGDVYTGKKFKISFNDSPTSTYLIYALD
GPLTLTKQGMNNLVASGKYNGVIQVAKLPSAEGEAILDAHHGVWPTTGTINTSKDGQVHF
NTSRYTIDWYKAGDVSKPLLTYAYPHHMKSFSLHSVKKTNLILQSSSKGPMQAVVGDQWT
LQESDLSRTEWFPERPSPERSTHNEILQQLASDVESNYTQHTQRGDNYFSGKGLQKVALT
ALVLNKPDVTGLRNPELAQLALDKLKQAFIPYLENRQEDPFRYDSVYKGIVSLAGLPVEM
GGTGNKDAAFGHSYYNDHHYHQGYFVVTAAIIHHLDPSWRAQELKAWTETLIRDVNNPVE
NDAYFAQFRNWDWFAGHSWAGGIKVDGALDGRDQESVPESVNFYWGTKLWGLATKNKSMQ
NLANLQLAVTKRTTYEYFWMLDGNKNRPKHMVENKVVGIYFEQKADYASIAALFHFDSIY
LEYIHGIQQLPMTPILADYMRTPEFVSQEWDQKLANVAPTVDSPWAGVLYLNYATINPAI
AYPILRHIAMDDGQTRSYSLYMAATRPNFYRRCK

Enzyme Prediction     

No EC number prediction in HMPREF1544_08255-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	53	741	1.8e-154	0.9903536977491961

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227785	Acf2	5.17e-133	9	744	27	753	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
407548	Glyco_hydro81C	3.73e-131	381	740	5	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
397619	Glyco_hydro_81	2.06e-57	68	372	15	316	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGV00786.1|GH81	0.0	44	752	42	749
CDS06153.1|GH81	0.0	17	751	5	734
UJR31943.1|GH81	4.86e-128	23	748	28	715
CCA25006.1|GH81	4.21e-109	22	745	27	735
AIG55599.1|GH81	8.79e-109	68	746	97	754

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K35_A	0.0	44	752	17	724	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
4K3A_A	0.0	44	752	17	724	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	0.0	44	752	42	749	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
6FOP_A	2.66e-24	372	741	309	651	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	5.80e-13	496	718	439	651	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZ24|ENG1_ARTBC	1.25e-99	17	744	178	900	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	4.37e-96	44	744	57	735	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|Q09850|ENG2_SCHPO	5.07e-95	47	744	15	700	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q12168|ENG2_YEAST	3.53e-75	17	740	59	772	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	6.17e-72	114	744	505	1139	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000196	0.999774	CS pos: 22-23. Pr: 0.9788

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1544_08255-t46_1-p1.