CAZyme Information: HMPREF1544_07971-t46_1-p1

Basic Information

• Species: Mucor circinelloides
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor circinelloides
• CAZyme ID: HMPREF1544_07971-t46_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
710	KE124016|CGC1	77086.08	5.1324

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mcircinelloides1006PhL	12410	1220926	183	12227

• Gene Location: location=KE124016:108949-111432(+)

Full Sequence      

MGESSTENVNVWKSSLRSSGTWSDVDYTAGCDARVASWPAQTHLTRTRALAAAYAKNPTD
SALLAKALLALNYWLDNDFTTNDCIDWGGNSAGSCPCGTPGLWNRNWYNQIIGTPTNIGG
ICLLLQNKLTSDQLASCTKIQARSYATIDTGLRTVSSYTGANLLDVASVGITLGLQNKDA
GILKDALEDFYRGVEISDKVAGDGIQSDGSFMQHAGLLYNGNYGKDYINDLLSVFIETKE
TDLAPPTSAQFAFETLMSGSEWMIIADAKLKSLLWQYSVIGRMVSFRYSDNQASGGVAIN
IDKVEASAEGWEKEADVLAITDRLQAPSTDDANQGDLVGTRYFYNSDYMVHRGSTYVVTM
KMYSTRTINSECLNVQNPYGFHLSDGAIHNYITGDEYVDTFGAWDWDLVPGITVDYGGTP
LQCTKVKNKGKKAFVGGATDGNTGIAVMDYLNPQNENLAFKKTVFFFPSGYAVQVGPVTS
KNTDAPLVTVLDQRRRNGDIYVSGNLRNTDTTYATTKSNSVWHDRIGYYFPTSENLFVNS
KPKASNWSDIGISEGTETQQLWTSYIKHASTTTTGLLTQYVVQPDISASTFNAKVAAGNI
PIALAFSASSPQVNAAYSAADKSIAAAFWTAGTYVTPWNSVTITTDNPCIFTFRETKDGT
YRLTVADPTQTLSSVKLTIKIGSVTKSTTATLPTGVTAGRYVVKTMYFSS

Enzyme Prediction     

EC	4.2.2.3:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL8	341	587	8.7e-46	0.9845559845559846

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396729	Lyase_8	3.39e-84	340	587	1	252	Polysaccharide lyase family 8, super-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
238517	GAG_Lyase	2.24e-78	37	668	60	693	Glycosaminoglycan (GAG) polysaccharide lyase family. This family consists of a group of secreted bacterial lyase enzymes capable of acting on glycosaminoglycans, such as hyaluronan and chondroitin, in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen. These are broad-specificity glycosaminoglycan lyases which recognize uronyl residues in polysaccharides and cleave their glycosidic bonds via a beta-elimination reaction to form a double bond between C-4 and C-5 of the non-reducing terminal uronyl residues of released products. Substrates include chondroitin, chondroitin 4-sulfate, chondroitin 6-sulfate, and hyaluronic acid. Family members include chondroitin AC lyase, chondroitin abc lyase, xanthan lyase, and hyalurate lyase.
400444	Lyase_8_N	2.71e-14	1	314	25	315	Polysaccharide lyase family 8, N terminal alpha-helical domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
397152	Lyase_8_C	1.11e-10	608	675	2	66	Polysaccharide lyase family 8, C-terminal beta-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV76798.1|PL8_4	2.67e-151	4	686	45	736
VWO96784.1|PL8_4	1.01e-150	8	706	120	818
QRW05707.1|PL8_4	3.60e-145	6	669	40	720
QRV91640.1|PL8_4	7.14e-145	6	669	40	720
QRW19613.1|PL8_4	8.20e-142	16	689	57	725

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CB8_A	8.41e-40	1	680	24	651	CHONDROITINASE AC LYASE FROM FLAVOBACTERIUM HEPARINUM [Pedobacter heparinus]
1HM2_A	9.95e-40	1	680	46	673	ACTIVE SITE OF CHONDROITINASE AC LYASE REVEALED BY THE STRUCTURE OF ENZYME-OLIGOSACCHARIDE COMPLEXES AND MUTAGENESIS [Pedobacter heparinus],1HM3_A Active Site Of Chondroitinase Ac Lyase Revealed By The Structure Of Enzyme-Oligosaccharide Complexes And Mutagenesis [Pedobacter heparinus],1HMU_A ACTIVE SITE OF CHONDROITINASE AC LYASE REVEALED BY THE STRUCTURE OF ENZYME-OLIGOSACCHARIDE COMPLEXES AND MUTAGENESIS [Pedobacter heparinus],1HMW_A Active Site Of Chondroitinase Ac Lyase Revealed By The Structure Of Enzyme-oligosaccharide Complexes And Mutagenesis [Pedobacter heparinus]
6F2P_A	8.80e-22	105	670	121	698	Structure of Paenibacillus xanthan lyase to 2.6 A resolution [Paenibacillus]
2WCO_A	5.73e-20	106	587	139	640	Structures of the Streptomyces coelicolor A3(2) Hyaluronan Lyase in Complex with Oligosaccharide Substrates and an Inhibitor [Streptomyces coelicolor A3(2)],2WDA_A The X-ray structure of the Streptomyces coelicolor A3 Chondroitin AC Lyase in Complex with Chondroitin sulphate [Streptomyces violaceoruber]
2X03_A	6.97e-19	106	587	139	640	The X-ray structure of the Streptomyces coelicolor A3 Chondroitin AC Lyase Y253A mutant [Streptomyces coelicolor A3(2)],2X03_B The X-ray structure of the Streptomyces coelicolor A3 Chondroitin AC Lyase Y253A mutant [Streptomyces coelicolor A3(2)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59288|CSLA_PEDHD	5.12e-39	1	680	46	673	Chondroitinase-AC OS=Pedobacter heparinus (strain ATCC 13125 / DSM 2366 / CIP 104194 / JCM 7457 / NBRC 12017 / NCIMB 9290 / NRRL B-14731 / HIM 762-3) OX=485917 GN=cslA PE=1 SV=1
sp|Q59801|HYSA_STAA8	3.43e-14	104	594	180	701	Hyaluronate lyase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=hysA PE=3 SV=1
sp|Q54873|HYSA_STRPN	4.00e-14	106	592	407	924	Hyaluronate lyase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_0314 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000039	0.000008

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1544_07971-t46_1-p1.