CAZyme Information: HMPREF1544_07928-t46_1-p1

Basic Information

• Species: Mucor circinelloides
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor circinelloides
• CAZyme ID: HMPREF1544_07928-t46_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
499		57707.51	6.3642

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mcircinelloides1006PhL	12410	1220926	183	12227

• Gene Location: location=KE124015:103731-105342(+)

Full Sequence      

MLLTLQFHRARISSAKPVNAFDAVSFISDDENYRVQVQEPVLDLLKVEELSSKYDIAVPH
PSLQWTEQDLAFFKSAAGETVFSQLVLIPEPKLPPNFVSITAAERLFKALFLHFDRILAK
DPLQDVQQDPSWTFFKRLENALYPWIHPHWDNAFHINNQTSGKGIVLCVGNNQFKFAAST
IRAIREVFHNTLPIEVFFIREKDLDIAKRRYLTSEFDNLTLMKLDDYVDDYYTKFGGWAM
KPFSMLASKFSEVIMMDADVFFFQDPGLLFDDEGYKMTGSLFYYDRTLFPNWTKGPDWMR
SFLPTMSSFVPKSRWFRGVSTHEQESGVVVMDKRKALLGLLSTCKMNGVTERNEVVYKHV
YGDKETYWVGFEVTQTPYAFVHSYAAVIGSHGRGDTDGSPEYICGNEIHLDTEGKPFWSN
GGLYRNKHAKNGLEYLNFTHFSTGDDWEFRTNCIKNKDTVHDIDPVQRAHASAFIEIDKK
RVLHQELLDKNKWNFKDTV

Enzyme Prediction     

No EC number prediction in HMPREF1544_07928-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	162	407	4.7e-49	0.9772727272727273

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402574	Mannosyl_trans3	4.79e-39	162	411	1	273	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS14050.1|GT71	2.61e-163	34	493	63	525
CDS05902.1|GT71	5.52e-160	47	493	84	527
UJR24372.1|GT71	1.10e-58	133	441	151	460
UJR24360.1|GT71	2.07e-56	137	427	163	455
UJO24859.1|GT71	4.73e-50	129	434	209	567

PDB Hits     

HMPREF1544_07928-t46_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AGA0|MNN1_CANAL	4.46e-20	113	423	320	666	Putative alpha-1,3-mannosyltransferase MNN1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN1 PE=2 SV=1
sp|Q59VL7|MNN15_CANAL	2.16e-16	156	423	258	578	Putative alpha-1,3-mannosyltransferase MNN15 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN15 PE=2 SV=2
sp|P39106|MNN1_YEAST	4.57e-14	15	422	196	625	Alpha-1,3-mannosyltransferase MNN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN1 PE=1 SV=1
sp|Q59YS7|MNN14_CANAL	9.87e-14	139	438	233	577	Putative alpha-1,3-mannosyltransferase MNN14 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN14 PE=2 SV=1
sp|P53745|MNT4_YEAST	1.14e-13	148	423	183	484	Probable alpha-1,3-mannosyltransferase MNT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNT4 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000039	0.000002

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1544_07928-t46_1-p1.