CAZyme Information: HMPREF1544_07692-t46_1-p1

Basic Information

• Species: Mucor circinelloides
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor circinelloides
• CAZyme ID: HMPREF1544_07692-t46_1-p1
• CAZy Family: GT15
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
548		61866.68	6.5381

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mcircinelloides1006PhL	12410	1220926	183	12227

• Gene Location: location=KE124010:41295-43058(-)

Full Sequence      

MLLSAAVSFALTAGLVVCSHLDTATSDPAYYYLDEQDVTFDRQPKNIVIATSIGGSSHAK
WVLEIGKVLADRGHNLTYVTRDDHLHLVDSYPEIKAVSAGRAIYPTTIVDDVLYKPFYDI
AKMVRKLLNSAYTEEMRFYRQGLHITPDFFICDAFDDPCIDTAVQFKTPFAITCTGILHQ
DISVPYMNGLGTTEHATSENMTLWQRFHHKYIDFVKTLYYLYPELKELDTLRQQFGISPL
GLNRFKQWDNALKLINSYFGFTPSQVLGPLTHMVGPIMTSKQKPLSREEQAFLDSHSRIA
YVAFGQYAVPLKHEIELLMSSLLDQVERKQLDGIIWVGLKEQVAKYESQNPNTVWKFTTT
ASTFDLPAPLFDNNLSQDVFMPSWANQFSVLGHPSTALFVSHGGATSANEATFHGVPLLV
HPYIGDQRLVGRALSVAGVARVHDRDGCTFDLLKSQLDELLFDADGYVARNLTRMKILAQ
FGHRRKSYAADLIEEHMFVAENGISSHRYESSRNMPKLKAMDIDLHFTVIAFIIVTGITF
HYMINTFS

Enzyme Prediction     

No EC number prediction in HMPREF1544_07692-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	272	466	1.2e-20	0.35340314136125656

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	3.87e-34	48	496	3	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
223071	egt	4.17e-16	200	543	197	501	ecdysteroid UDP-glucosyltransferase; Provisional
278624	UDPGT	1.17e-13	254	428	230	373	UDP-glucoronosyl and UDP-glucosyl transferase.
273616	MGT	3.88e-13	384	494	282	387	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
224732	YjiC	5.75e-13	52	506	8	406	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOC55050.1|GT1	2.55e-78	44	526	37	513
AOC55049.1|GT1	5.35e-73	39	536	28	520
CDS06891.1|GT1	2.92e-59	40	547	41	541
CDS06902.1|GT1	2.73e-57	35	534	30	522
CDS05133.1|GT1	2.79e-56	34	508	17	440

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IPB_A	7.01e-12	275	462	19	179	Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_B Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_C Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_D Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens]
7CJX_A	9.14e-11	278	462	1	158	Chain A, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_B Chain B, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_C Chain C, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_D Chain D, UDP-glucuronosyltransferase 2B15 [Homo sapiens]
2VCE_A	5.17e-09	244	447	203	409	Characterization and engineering of the bifunctional N- and O- glucosyltransferase involved in xenobiotic metabolism in plants [Arabidopsis thaliana],2VCH_A Characterization and engineering of the bifunctional N- and O- glucosyltransferase involved in xenobiotic metabolism in plants [Arabidopsis thaliana],2VG8_A Characterization and engineering of the bifunctional N- and O- glucosyltransferase involved in xenobiotic metabolism in plants [Arabidopsis thaliana]
2O6L_A	2.43e-08	283	427	5	118	Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens],2O6L_B Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens]
3HBF_A	4.61e-08	274	429	245	379	Structure of UGT78G1 complexed with myricetin and UDP [Medicago truncatula],3HBJ_A Structure of UGT78G1 complexed with UDP [Medicago truncatula]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q1LZI1|UD3A1_BOVIN	5.38e-14	48	427	25	394	UDP-glucuronosyltransferase 3A1 OS=Bos taurus OX=9913 GN=UGT3A1 PE=2 SV=1
sp|O77649|UDB20_MACFA	1.21e-12	198	462	203	439	UDP-glucuronosyltransferase 2B20 OS=Macaca fascicularis OX=9541 GN=UGT2B20 PE=1 SV=1
sp|P19224|UD16_HUMAN	8.70e-12	57	460	37	422	UDP-glucuronosyltransferase 1-6 OS=Homo sapiens OX=9606 GN=UGT1A6 PE=1 SV=2
sp|P54855|UDB15_HUMAN	1.15e-11	208	462	217	439	UDP-glucuronosyltransferase 2B15 OS=Homo sapiens OX=9606 GN=UGT2B15 PE=1 SV=3
sp|Q9LFJ8|U78D2_ARATH	2.98e-11	267	479	247	435	Flavonol 3-O-glucosyltransferase OS=Arabidopsis thaliana OX=3702 GN=UGT78D2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.003730	0.996262	CS pos: 17-18. Pr: 0.9065

TMHMM  Annotations     

Start	End
523	545