CAZyme Information: HMPREF1544_07044-t46_1-p1

Basic Information

• Species: Mucor circinelloides
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor circinelloides
• CAZyme ID: HMPREF1544_07044-t46_1-p1
• CAZy Family: GH9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
298		33247.84	4.5535

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mcircinelloides1006PhL	12410	1220926	183	12227

• Gene Location: location=KE123995:20772-21856(+)

Full Sequence      

MALAQDVEDPAEDADPSRSEQDDQAIVSSVMYAPVPTNRIAVNRHQLPPPEYIATSGEQK
TVCKNYRTDFSKDTTGWQVENSMQDTYDINGNGLEFHLLHPSKYIRLHDQNYLPYNEIGG
RGPTLNATSYMRYGRVSALMRSAGTGGAVTAFILMADGGDEIDFEFLGGDRDLVQSNYFW
GQSKEYNVNGGIHKVEGGTIDTAFHKYTIDWKPDKIEWLVDDKVVRTRIKSETCGANGVC
KFPSQPARVQFGLWDGSIESGTAEWSRGPIDWSAPQSIQAFIKSVQLDCDPEYNQIVN

Enzyme Prediction     

No EC number prediction in HMPREF1544_07044-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	121	271	6.2e-45	0.8735632183908046

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185692	GH16_fungal_CRH1_transglycosylase	1.24e-55	122	289	36	201	glycosylphosphatidylinositol-glucanosyltransferase. Group of fungal GH16 members related to Saccharomyces cerevisiae Crh1p. Chr1p and Crh2p are transglycosylases that are required for the linkage of chitin to beta(1-3)glucose branches of beta(1-6)glucan, an important step in the assembly of new cell wall. Both have been shown to be glycosylphosphatidylinositol (GPI)-anchored. A third homologous protein, Crr1p, functions in the formation of the spore wall. They belongs to the family 16 of glycosyl hydrolases that includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
395585	Glyco_hydro_16	5.22e-41	122	273	22	167	Glycosyl hydrolases family 16.
185683	Glyco_hydrolase_16	3.83e-22	132	279	66	205	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185684	GH16_lichenase	3.71e-20	133	275	68	200	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
185685	GH16_XET	1.67e-19	128	275	44	190	Xyloglucan endotransglycosylase, member of glycosyl hydrolase family 16. Xyloglucan endotransglycosylases (XETs) cleave and religate xyloglucan polymers in plant cell walls via a transglycosylation mechanism. Xyloglucan is a soluble hemicellulose with a backbone of beta-1,4-linked glucose units, partially substituted with alpha-1,6-linked xylopyranose branches. It binds noncovalently to cellulose, cross-linking the adjacent cellulose microfibrils, giving it a key structural role as a matrix polymer. Therefore, XET plays an important role in all plant processes that require cell wall remodeling.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS13191.1|GH16	5.70e-108	54	297	20	264
CDS10243.1|GH16	1.28e-80	63	298	33	274
CDS12756.1|GH16	4.48e-43	120	298	2	145
QRW19139.1|CBM18|GH16_19	2.09e-35	55	291	34	276
AEO57264.1|CBM18|GH16_19	8.99e-35	122	276	123	279

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IBU_A	6.62e-28	120	288	57	222	Apo Crh5 transglycosylase [Aspergillus fumigatus Af293],6IBU_B Apo Crh5 transglycosylase [Aspergillus fumigatus Af293],6IBW_A Crh5 transglycosylase in complex with NAG [Aspergillus fumigatus Af293],6IBW_B Crh5 transglycosylase in complex with NAG [Aspergillus fumigatus Af293]
5SV8_A	7.37e-15	122	275	44	191	Crystal Structure of the catalytic nucleophile and surface cysteine mutant of VvEG16 in complex with a xyloglucan oligosaccharide [Vitis vinifera]
5DZE_A	1.88e-14	122	275	43	190	Crystal Structure of the catalytic nucleophile mutant of VvEG16 in complex with cellotetraose [Vitis vinifera]
5DZF_A	1.92e-14	122	275	44	191	Crystal Structure of the catalytic nucleophile mutant of VvEG16 in complex with a mixed-linkage glucan octasaccharide [Vitis vinifera],5DZF_B Crystal Structure of the catalytic nucleophile mutant of VvEG16 in complex with a mixed-linkage glucan octasaccharide [Vitis vinifera]
5DZG_A	1.95e-14	122	275	45	192	Crystal Structure of the catalytic nucleophile mutant of VvEG16 in complex with a xyloglucan tetradecasaccharide [Vitis vinifera],5DZG_B Crystal Structure of the catalytic nucleophile mutant of VvEG16 in complex with a xyloglucan tetradecasaccharide [Vitis vinifera]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WI46|CRF2_ASPFU	1.01e-30	102	274	105	280	Probable glycosidase crf2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=crf2 PE=1 SV=1
sp|Q5AJC0|UTR2_CANAL	2.15e-27	122	274	129	282	Extracellular glycosidase UTR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=UTR2 PE=1 SV=1
sp|P32623|CRH2_YEAST	3.64e-26	122	291	127	303	Probable glycosidase CRH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UTR2 PE=1 SV=3
sp|Q8J0P4|CRF1_ASPFU	4.56e-26	120	288	78	243	Probable glycosidase crf1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=crf1 PE=1 SV=2
sp|Q05790|CRR1_YEAST	1.09e-24	122	279	178	338	Probable glycosidase CRR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CRR1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000002

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1544_07044-t46_1-p1.