CAZyme Information: HMPREF1544_06671-t46_1-p1

Basic Information

• Species: Mucor circinelloides
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor circinelloides
• CAZyme ID: HMPREF1544_06671-t46_1-p1
• CAZy Family: GH72
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
511		57983.62	8.0670

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mcircinelloides1006PhL	12410	1220926	183	12227

• Gene Location: location=KE123987:24186-25801(-)

Full Sequence      

MINFKSILKRVGSATSLSSYGSNSSSESSTKSSLCSLNQEDLPTFAPYNQQEADMYRHRR
QIGVNLGSIFILDKQLAPPSLLSCVVRDDWESELDFLEACMTEEQAKEALEDHWSSVVSE
RDFEYLSSIGVNSVRVPIGYWIVGLFVNGPFKKYESVYQSAWKWFLRMISMAAKYNMGVL
VDLHGAPGGQNIQPHSGTSTHKAQFFKNSNQEFTLIILRKLAIQLAPINNVIGLDILNEP
LDETASLQNFYLSAYKTIRQATPGILLPIYMSDAFNSTRYAEFIKHHSLKFVVLDIHYPF
NAFKRPSAAANRRSSLVAFNQPSHPSAETKRHLSHTHLKKISHQLHGNLIVGEWSSSLEH
VQDVKKIRDFTQFQLDIYNDIEAGHYFWNYRTTDDGNYSSFVYCHKTRVLPAHCSRLDAI
AAQEVSELAKSRYTRCLSAAGKQEDQDFKQGFKAGFELALVYLLKHHAQVGFKRQLAHGH
SRKKHPSYEKGFTSALYVVDHIIHEFVADAD

Enzyme Prediction     

No EC number prediction in HMPREF1544_06671-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	110	394	1.1e-77	0.9929328621908127

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	4.56e-25	110	399	66	371	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
311610	Glyco_hydro_53	3.33e-04	123	300	30	209	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.
395098	Cellulase	0.002	130	263	37	159	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS09041.1|GH5_50	1.18e-113	43	495	31	495
SHO78070.1|GH5_50	2.39e-54	45	390	111	454
QRW07957.1|GH5_50	1.20e-53	42	424	38	418
QRV79062.1|GH5_50	1.65e-53	42	424	38	418
AXA51796.1|GH5_50	2.89e-52	45	390	111	454

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3O6A_A	8.35e-26	63	275	16	228	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
1CZ1_A	1.44e-25	63	275	11	223	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
1EQP_A	1.44e-25	63	275	11	223	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
4M80_A	1.54e-25	63	275	16	228	The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans at 1.85A resolution [Candida albicans SC5314],4M81_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with 1-fluoro-alpha-D-glucopyranoside (donor) and p-nitrophenyl beta-D-glucopyranoside (acceptor) at 1.86A resolution [Candida albicans SC5314],4M82_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with p-nitrophenyl-gentiobioside (product) at 1.6A resolution [Candida albicans SC5314]
2PB1_A	1.56e-25	63	275	17	229	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O74799|EXG3_SCHPO	3.77e-37	54	474	7	423	Glucan 1,3-beta-glucosidase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=exg3 PE=3 SV=1
sp|P38081|YBQ6_YEAST	1.94e-28	42	297	26	295	Uncharacterized glycosyl hydrolase YBR056W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YBR056W PE=1 SV=1
sp|P29717|EXG1_CANAL	1.24e-24	63	275	55	267	Glucan 1,3-beta-glucosidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=XOG1 PE=1 SV=5
sp|Q12700|EXG_SCHOC	3.60e-24	56	298	37	280	Glucan 1,3-beta-glucosidase OS=Schwanniomyces occidentalis OX=27300 PE=3 SV=1
sp|O93983|EXG2_WICAO	1.82e-22	56	277	37	256	Glucan 1,3-beta-glucosidase 2 OS=Wickerhamomyces anomalus OX=4927 GN=EXG2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999736	0.000296

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1544_06671-t46_1-p1.