CAZyme Information: HMPREF1544_06494-t46_1-p1

Basic Information

• Species: Mucor circinelloides
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor circinelloides
• CAZyme ID: HMPREF1544_06494-t46_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1424		160724.15	5.7613

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mcircinelloides1006PhL	12410	1220926	183	12227

• Gene Location: location=KE123983:65739-70572(+)

Full Sequence      

MTISSRQHTQDRLDYYYKVINKTIIAKQNASSGLMPASTAITSHGDYTDAWVRDNVYSIY
AVYGLALAYKRLDDNTGRAFELQHSVVKLMRGLLFAMMRQSAKVEKFKQTQSLEHSLHAK
YNTQTGETVVGDFEWGHLQIDATSFFLLALADMTAGGFNIIYSQDEVDFVQNLVFYIERA
YRTPDYGIWERGNKINHGQPELNSSSIGMAVAALRAINGVNLFGARGGPSSVIHVLPDEL
TRNATTLHSFLPRESNSKEIDGSVLSIIGFPAFAVDDPELIQRTREEAVKKLEGKYGMKR
FLRDGHQTTVEDTSRLYYDPNELKVFEDIESEWPLFFTYMVLEGLFTGDLEQAENYRKKL
EPLIVDSVAMSRPLPSKSNSSSSTSTSHNHVRSDSIPLNHINEDTDNEDDEEEESIHIPL
LPELYYVPAESIHAEKENPHSQKRVPNENVPLVWALSLYFLGGLITEDLLSPSEVDPLGR
RFNSTKMVKDTMIQIVLLSEDQQLQTALSTYGLETQTLDQISTTTTVLPPQALVDVYGGL
GLNSKMEMTGRPKRPIGVLGTSRFYKIQGQTYAFTPHFMDNNEFYINADPDYLVSEFENE
LTFTKKNWYYPGRPTMVVLLSHGLLGTTKESNNLLLSNSADASKKNLLNFFTNLRGGYAC
EGDVRVKLCRLAETINTSNIQSLDFLINKPEVNWKRILRVAHASRTHKKKLGYNEYKTQA
STPGHRTPGGDLMSGGRTPKRKNTTFYGKSLASPLDKLHDENYFDQLATALSQLKANSEQ
QQQFKLKSHETNKQPALSESPTSGIFTPGSTTNKTGSVPKQNPDQSGSPHEMLSLTLGDS
SQFDQAVESLRASVNLYDQIDLLQYMVSCRPMSYYVEALETTILELLEEVYLKSKKSKYW
SIARQAAGLLHKNVPSLTINITDLVIRQKQVSIGSGPQEYLISMPVAPDTLNKMISEHCT
DDVREGPVVQEIIIYLGNLIRTQPDMFEGILRLRTHYIIIALREEISRINNSDAEESVEH
LMQLSPFELESLLSTVLSGPHLCRMNNLVVRDRPGGFLMLSTNNSVYKNDKAADSNTYIP
LISDFQNSLSIKAQSGGYFSGNFAKVEINGTVMEANSRGIHVWAIDRSQNIILERASFDT
HISEEESRAFVQFIHSIANGVVILIASKDEFIENLTHEAIVTLQQLGSTKINDVQYRDSY
VFIGEKGDTEHIVEGHQLSKEGPTEQIEKTFDLDSELFSNQNAQITMENLHNFFPNSNGR
WLRRRKNDGALNRVPSSNFFPQVWSILDKSKGLCIRNHSLPRDPIVLEKTPEEFNFALAV
ESFLGWFTDPAERQVAVEVLSIIYQQQDQQRDVWFDLPAIINRAIEKFWVKWIELNKSSI
ERGGHVFENGSSYHQHADLARRLFFDLPLDGTESTSTYIKSSLF

Enzyme Prediction     

No EC number prediction in HMPREF1544_06494-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH15	16	324	5.3e-18	0.7728531855955678

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395586	Glyco_hydro_15	1.35e-61	10	252	1	226	Glycosyl hydrolases family 15. In higher organisms this family is represented by phosphorylase kinase subunits.
406202	ILEI	6.30e-28	1118	1207	1	89	Interleukin-like EMT inducer. ILEI is a family of proteins found in vertebrates. It is heavily involved in the process of the transition from epithelial to mesenchymal tissue - EMT - during all of embryonic development, cancer progression, metastasis, and chronic inflammation/fibrosis. ILEI is upregulated exclusively at the level of translation, and abnormal ILEI expression, ie cytoplasmic over-expression instead of vesicular localization, is associated with EMT in human cancerous tissue. In order to induce and maintain the EMT of hepatocytes in a TGF-beta-independent fashion ILEI needs the cooperation of oncogenic Ras.
260110	PANDER_like	5.22e-26	1091	1233	3	149	Domains similar to the Pancreatic-derived factor. FAM3B or PANDER (PANcreatic DERived factor) has been identifed as a regulator of glucose homeostasis and beta cell function. The protein is expressed in the endocrine pancreas and co-secreted with insulin in response to glucose, particularly under conditions of insulin resistance. The protein had initially been predicted to be a member of the four-helical cytokine family, hence the FAM3B designation. This wider family contains FAM3B and FAM4C, N-terminal domains of N-acetylglucosaminyltransferases, and domains in poorly characterized proteins that have been associated with deafness and the progression of cancer.
260112	PANDER_like_TMEM2	8.37e-21	1117	1216	47	146	PANDER-like domain of the transmembrane protein TMEM2. TMEM2 has been characterized as a transmembrane protein that maps to the DFNB7-DFNB11 deafness locus on human chromosome 9. It contains a domain similar to the Pancreatic-derived factor PANDER, C-terminal to a glycine rich G8-domain. The function of the PANDER-like domain in TMEM2 has not been characterized.
260111	PANDER_GnT-1_2_like	3.15e-16	1089	1220	1	129	PANDER-like domain of N-acetylglucosaminyltransferases. O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1 participates in O-mannosyl glycosylation and may be responsible for creating GlcNAc(beta1-2)Man(alpha1-)O-Ser/Thr moieties on alpha dystroglycan and other O-mannosylated proteins. The domain characterized by this model lies N-terminal to the catalytic domain. Its function has not been determined.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS03190.1|GH0	0.0	11	1207	16	1235
BAY07794.1|GH0	2.60e-245	12	1038	9	860
AVZ29899.1|GH0	7.95e-245	10	1039	8	862
ULP73450.1|GH0	4.40e-244	10	1039	8	862
BAY93985.1|GH0	1.73e-243	12	1098	10	904

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5LC3_A	4.34e-07	1118	1207	80	167	Xray structure of mouse FAM3C ILEI monomer [Mus musculus],5LC3_B Xray structure of mouse FAM3C ILEI monomer [Mus musculus],5LC4_A Xray structure of mouse FAM3C ILEI dimer [Mus musculus],5LC4_B Xray structure of mouse FAM3C ILEI dimer [Mus musculus],5LC4_C Xray structure of mouse FAM3C ILEI dimer [Mus musculus],5LC4_D Xray structure of mouse FAM3C ILEI dimer [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P18826|KPB1_MOUSE	3.23e-217	5	1348	3	1157	Phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform OS=Mus musculus OX=10090 GN=Phka1 PE=1 SV=3
sp|P18688|KPB1_RABIT	1.28e-214	5	1348	3	1153	Phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform OS=Oryctolagus cuniculus OX=9986 GN=PHKA1 PE=1 SV=1
sp|Q64649|KPB1_RAT	6.04e-213	5	1348	3	1158	Phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform OS=Rattus norvegicus OX=10116 GN=Phka1 PE=1 SV=2
sp|P46020|KPB1_HUMAN	5.38e-212	5	1348	3	1139	Phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform OS=Homo sapiens OX=9606 GN=PHKA1 PE=1 SV=2
sp|P46018|KPB2_RABIT	1.11e-210	5	1352	3	1156	Phosphorylase b kinase regulatory subunit alpha, liver isoform OS=Oryctolagus cuniculus OX=9986 GN=PHKA2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998679	0.001330

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1544_06494-t46_1-p1.