CAZyme Information: HMPREF1544_06444-t46_1-p1

Basic Information

• Species: Mucor circinelloides
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor circinelloides
• CAZyme ID: HMPREF1544_06444-t46_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
851		93970.68	6.1148

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mcircinelloides1006PhL	12410	1220926	183	12227

• Gene Location: location=KE123982:31223-33778(-)

Full Sequence      

MTKTDLQHDIGQLLMCGFHGLEATEGILDLIRHHNLGSIIFFSRNIESPKQLQRLTHTLQ
TAAKEAGHTRPLLIAVDQENGVVRRLGSSGTYLPGSMALGAIDSTSAAHQVATATAKELL
ALGVNWNLAPSMDVNNNALNPVIGVRSFGENPHLVAELGLAQVEAYHRHRVATSIKHFPG
HGDTATDSHLGVPVIDKSLDELAQTELVPFTHCINAQGDAHPTSVMIGHIALPQIIVEEN
RPASISSEIATDLLRKKLGYQGIIITDCLEMDAVKDTVGSARGAVMALQAGNDISMLSHT
LSFQQDAFKLLGQAIQNGTLDEDALSASLERVAALKDRFLSWDVVLRNQDLADVGCKAHL
ELSDRLYNKVPTVVCDQQQYLPIKPSQDDKILFLAANVPLTLAIDSEAEPFNSMYDSLHR
RHANTEYIIFKQDTPDLTDAIKSADIVIVGTANGNLHPFQADLVQLASLHAKKLIVIAVI
NPYDLMAFPSISTYLVTYEYTPPAHEAAVRLIFGEIPQSSSLPVTIPNTSTHAAQKHWKI
APYSDQDTQQAHALWNRIYHTSWPLSLENFSLVLSRLQKPRHFCVYDQDVLVGFAATQTI
EKTGQLALLIVHPDYQNRGIGTKLNDHCLDIFRKEGASSVMLGSSYPRFFCGVPDDDILG
QQAQGFFSRRGYTLTQLVWDLMGDIRNYTIPAALTARMEKEGIWFGTIDPTEIGDLIAFQ
KRYFDYWVSTYEHHANLGDYQDLVVAREGDKDGKIVGSLVLYTTEGSHAYRSDLIWTDNS
LFTEKSGGMACVGVATEERGRGIGIGLVSYANQMLKGRGVNLSYVDWVELIDFYSRTGYQ
KWRSYRLGAMK

Enzyme Prediction     

EC	3.2.1.52:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	68	296	1.3e-60	0.9629629629629629

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	2.94e-84	1	336	1	312	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	1.78e-82	6	335	2	316	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	2.07e-50	14	343	4	314	beta-hexosaminidase; Provisional
185053	PRK15098	2.80e-17	1	296	42	319	beta-glucosidase BglX.
395465	Acetyltransf_1	2.65e-11	549	672	2	116	Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGC24356.1|GH3|3.2.1.52	0.0	5	848	8	856
CDS12545.1|GH3	0.0	1	849	1	842
BCR93582.1|GH3	3.78e-161	1	850	1	857
BCS06215.1|GH3	3.78e-161	1	850	1	857
BCR85716.1|GH3	4.62e-161	1	850	1	854

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	0.0	5	848	8	856	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	1.89e-88	6	529	13	534	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	5.43e-79	1	530	39	621	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	1.54e-78	1	530	13	595	Chain A, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	3.17e-78	1	530	43	625	Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40406|NAGZ_BACSU	2.79e-78	1	530	39	621	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|P48823|HEXA_PSEO7	3.53e-66	29	526	57	596	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
sp|B4SRK3|NAGZ_STRM5	5.63e-39	13	360	1	327	Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain R551-3) OX=391008 GN=nagZ PE=3 SV=1
sp|B2FPW9|NAGZ_STRMK	3.55e-38	13	346	1	315	Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=nagZ PE=3 SV=1
sp|B2I6G9|NAGZ_XYLF2	4.76e-36	13	299	1	279	Beta-hexosaminidase OS=Xylella fastidiosa (strain M23) OX=405441 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000000

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1544_06444-t46_1-p1.