CAZyme Information: HMPREF1544_06187-t46_1-p1

Basic Information

• Species: Mucor circinelloides
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor circinelloides
• CAZyme ID: HMPREF1544_06187-t46_1-p1
• CAZy Family: GH47
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
465	KE123977|CGC1	53682.32	6.1592

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mcircinelloides1006PhL	12410	1220926	183	12227

• Gene Location: location=KE123977:9664-11238(-)

Full Sequence      

MEALAVNQQQQQDVLMQSDASSSSSSSSFTSSSTTYTKPKLQHSGSKEDAEDVEYTNQVT
WPGSKGSEINHKLSEEIMKSKIFSSSMGLDNVTPYYFKASHITETQDITLATLVTRNRFH
VLSRLATNYKGPISAAIHVLDDGEKVATIKELGKIYSSNPNMQKYVDVHLIIDKFDRQFN
MWRNTAKLFTRTDYLMMLDVDFHLCTNFRKTIFGNPTIANMLAAGKTAIVVPAFEYLNQK
DGMDYKKFPTKKSQVIKQVQDMKLDSFHSSWVSGHGATNYSHWYTATEMYPVTEYEFSYE
PYVIYKKEGTPWCDERFIGYGANKAACLFEIFISGVDYYVLPNDFLIHQSHKYANHDRTR
ERTHNRVLYENFRTEICLRYSRKYVIEETWYTPAAKNMKQVCTDIPKWKYLSGISKEQRL
KDLEEEAALKAQQEQETQQTSLDVETVQLSEQEQEEQDEEIIATI

Enzyme Prediction     

No EC number prediction in HMPREF1544_06187-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT49	99	382	4.3e-44	0.8308605341246291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404735	Glyco_transf_49	2.05e-48	107	380	1	326	Glycosyl-transferase for dystroglycan. This glycosyl-transferase brings about the glycosylation of the alpha-dystroglycan subunit. Dystroglycan is an integral member of the skeletal muscular dystrophin glycoprotein complex, which links dystrophin to proteins in the extracellular matrix.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS06217.1|GT49	4.89e-154	43	409	66	428
CDS09884.1|GT49	2.96e-152	59	402	39	380
CDS06289.1|GT49	3.71e-151	58	405	69	414
CDS10115.1|GT49	8.73e-146	73	405	87	419
CDS14203.1|GT49	3.77e-144	59	409	69	421

PDB Hits     

HMPREF1544_06187-t46_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O95461|LARG1_HUMAN	2.06e-26	96	397	462	755	Xylosyl- and glucuronyltransferase LARGE1 OS=Homo sapiens OX=9606 GN=LARGE1 PE=1 SV=1
sp|Q9Z1M7|LARG1_MOUSE	4.97e-26	95	397	463	755	Xylosyl- and glucuronyltransferase LARGE1 OS=Mus musculus OX=10090 GN=Large1 PE=1 SV=1
sp|Q66PG3|LARG1_CHICK	1.24e-24	96	397	462	755	Xylosyl- and glucuronyltransferase LARGE1 OS=Gallus gallus OX=9031 GN=LARGE1 PE=2 SV=1
sp|Q66PG2|LARG1_DANRE	2.97e-24	96	384	463	743	Xylosyl- and glucuronyltransferase LARGE1 OS=Danio rerio OX=7955 GN=large1 PE=2 SV=1
sp|Q5XPT3|LARG2_MOUSE	3.81e-22	104	351	399	638	Xylosyl- and glucuronyltransferase LARGE2 OS=Mus musculus OX=10090 GN=Large2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000064	0.000003

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1544_06187-t46_1-p1.