CAZyme Information: HMPREF1544_06115-t46_1-p1

Basic Information

• Species: Mucor circinelloides
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor circinelloides
• CAZyme ID: HMPREF1544_06115-t46_1-p1
• CAZy Family: GH47
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
382	KE123975|CGC1	43923.88	8.4122

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mcircinelloides1006PhL	12410	1220926	183	12227

• Gene Location: location=KE123975:74873-76278(+)

Full Sequence      

MGPRKPEVEYISLRKLQLQKQTGPTERTKEAYKCLERLANNALNNGPFSVTFDKKQPHMA
PTGDARDFLSYAPYWWPENPQDPNTRYIRKDGKRNPDIGNVKDQFQLESVAENLQFLCLG
YYFFNNENYAIYAVSLLDTFFVNEKTRMNPNLNYAQFVRGSQNHSPFGRGEGVISSRVLS
RIVNLLPLLDAFHGYYALRQYIHSWFDAYLNWLQSSPVALEAAAARNNIHTWYIVQLASI
EQFLNPVSPQVSNVLFRFFKESLPKQMDPKTGNQPYESKRTKPLHYLAFNLQAIVILAEL
ARDTGLDVYRSNEPILLATYIANKYGPDENQDITEAVRCIEIISNAIQGQNEVCRCFIDK
AYHCKFSEKLGGPKNAIHVLWS

Enzyme Prediction     

No EC number prediction in HMPREF1544_06115-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL38	56	313	6.4e-81	0.9032258064516129

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398861	Alginate_lyase	7.42e-52	61	314	11	252	Alginate lyase. This family contains several bacterial alginate lyase proteins. Alginate is a family of 1-4-linked copolymers of beta -D-mannuronic acid (M) and alpha -L-guluronic acid (G). It is produced by brown algae and by some bacteria belonging to the genera Azotobacter and Pseudomonas. Alginate lyases catalyze the depolymerization of alginates by beta -elimination, generating a molecule containing 4-deoxy-L-erythro-hex-4-enepyranosyluronate at the nonreducing end. This family adopts an all alpha fold.
234727	algL	0.005	275	323	238	289	polysaccharide lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFA26126.1|PL38	1.58e-193	1	382	1	381
AFA26122.1|PL38	2.24e-193	1	382	1	381
CDS07499.1|PL38	1.70e-114	1	381	1	379
QEC55803.1|PL38	5.20e-52	31	314	55	329
AEU38559.1|PL38	5.40e-51	5	314	29	326

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NFV_A	1.10e-35	31	311	29	302	Crystal structure of an alginate lyase (BACOVA_01668) from Bacteroides ovatus at 1.95 A resolution [Bacteroides ovatus ATCC 8483],3NNB_A Crystal structure of an alginate lyase (BACOVA_01668) from Bacteroides ovatus at 1.60 A resolution [Bacteroides ovatus ATCC 8483]

Swiss-Prot Hits     

HMPREF1544_06115-t46_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000000

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1544_06115-t46_1-p1.