CAZyme Information: HMPREF1544_05965-t46_1-p1

Basic Information

• Species: Mucor circinelloides
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor circinelloides
• CAZyme ID: HMPREF1544_05965-t46_1-p1
• CAZy Family: GH47
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
693	KE123972|CGC2	76983.94	4.3606

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mcircinelloides1006PhL	12410	1220926	183	12227

• Gene Location: location=KE123972:80345-82483(-)

Full Sequence      

MSNLVSPLFVLLLLLLAFRFAHAGVDLNVGVDISPSNTARKFYFNITLAQLNPDCNASFI
SPVINGQFPGPAIHVVKNDIIQLHIYNDPAHNFSSSIHIHGIRQYGSNRFDGVAGITQMA
IAPGETFIQEFQVLNQTGTFYYHAHVGVQDDTIQGPFIVHETKEHLDNYANNEIILHWGE
WWHQSFHDRYEYYMSPRFVGDGGPDSVLLNGRSIYANTSINAAGAASPDCKGFTYFDVEP
NKTYLVRVIGALTFRTLGIAVQGHDMTLVEIDAEPVQPHKVAYLELSAGQRMAFTITTGN
HAAGSVFPILSNYRYRGQGLGYTPNGYGFLRYVDPAVTNKQEPVSFLTTPLVKDLPDNIF
PLVDTAGWITSELKPGATYPSDFILSESATRTIKLALKEVDMPDNTTRFIVNGRDYVAEP
WGNATMSLIDRVLAEPDLGALDAGDGFSFAHQTYPLGLGEIVDLVFQNVQLPTGNCVLHP
WHTHGHSHYLLAEGPGDYNHETDKDIRTYPTPIYRDVSMVYPRIVNDTENCGWTKVRIFT
DNPGVWPVHCHITAHMLQGKMVVLEVAPKKLDEYYVPGGYQTLKQDGSSEQSGSTKPTDQ
TGQAPESQAEAEDNDDAQKNEGSNDLQEEDNDGHQDNNDDVDSQQEESEQDNDRYGEDGY
SDEQDEGGDESLEAYDKGGVDEEDTEDEHVKYD

Enzyme Prediction     

No EC number prediction in HMPREF1544_05965-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA1	63	559	2.9e-83	0.9581005586592178

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
132431	ascorbOXfungal	3.42e-71	46	563	15	528	L-ascorbate oxidase, fungal type. This model describes a family of fungal ascorbate oxidases, within a larger family of multicopper oxidases that also includes plant ascorbate oxidases (TIGR03388), plant laccases and laccase-like proteins (TIGR03389), and related proteins. The member from Acremonium sp. HI-25 is characterized.
274555	ascorbase	3.60e-71	39	565	1	522	L-ascorbate oxidase, plant type. Members of this protein family are the copper-containing enzyme L-ascorbate oxidase (EC 1.10.3.3), also called ascorbase. This family is found in flowering plants, and shows greater sequence similarity to a family of laccases (EC 1.10.3.2) from plants than to other known ascorbate oxidases.
177843	PLN02191	6.20e-66	34	564	18	544	L-ascorbate oxidase
215324	PLN02604	1.44e-58	40	565	25	545	oxidoreductase
274556	laccase	1.92e-48	39	564	3	518	laccase, plant. Members of this protein family include the copper-containing enzyme laccase (EC 1.10.3.2), often several from a single plant species, and additional, uncharacterized, closely related plant proteins termed laccase-like multicopper oxidases. This protein family shows considerable sequence similarity to the L-ascorbate oxidase (EC 1.10.3.3) family. Laccases are enzymes of rather broad specificity, and classification of all proteins scoring about the trusted cutoff of this model as laccases may be appropriate.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS06551.1|AA1	3.05e-144	18	574	4	648
CDS06185.1|AA1	3.39e-125	34	568	10	567
CDS12532.1|AA1	3.92e-122	40	571	28	573
CDS07261.1|AA1	4.66e-101	40	539	23	520
AIG56331.1|AA1	1.00e-64	46	573	37	522

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1AOZ_A	7.40e-56	40	571	4	528	Refined Crystal Structure Of Ascorbate Oxidase At 1.9 Angstroms Resolution [Cucurbita pepo var. melopepo],1AOZ_B Refined Crystal Structure Of Ascorbate Oxidase At 1.9 Angstroms Resolution [Cucurbita pepo var. melopepo],1ASO_A X-Ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-Forms [Cucurbita pepo var. melopepo],1ASO_B X-Ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-Forms [Cucurbita pepo var. melopepo],1ASP_A X-ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-forms [Cucurbita pepo var. melopepo],1ASP_B X-ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-forms [Cucurbita pepo var. melopepo],1ASQ_A X-Ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-Forms [Cucurbita pepo var. melopepo],1ASQ_B X-Ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-Forms [Cucurbita pepo var. melopepo]
3PXL_A	1.99e-44	46	564	10	467	Type-2 Cu-depleted fungus laccase from Trametes hirsuta [Trametes hirsuta]
1GYC_A	2.71e-44	63	563	26	466	Chain A, LACCASE 2 [Trametes versicolor]
3FPX_A	5.07e-44	46	564	10	467	Native fungus laccase from Trametes hirsuta [Trametes hirsuta],3V9C_A Type-2 Cu-depleted fungus laccase from Trametes hirsuta at low dose of ionization radiation [Trametes hirsuta]
5LDU_A	1.56e-42	46	564	10	467	Recombinant high-redox potential laccase from Basidiomycete Trametes hirsuta [Trametes hirsuta]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P24792|ASO_CUCMA	5.37e-58	24	571	19	558	L-ascorbate oxidase OS=Cucurbita maxima OX=3661 GN=AAO PE=1 SV=2
sp|Q40588|ASO_TOBAC	9.05e-56	25	563	17	547	L-ascorbate oxidase OS=Nicotiana tabacum OX=4097 GN=AAO PE=2 SV=1
sp|Q8LPL3|ASO_ARATH	1.14e-55	53	577	37	554	L-ascorbate oxidase OS=Arabidopsis thaliana OX=3702 GN=AAO PE=1 SV=1
sp|P37064|ASO_CUCPM	3.81e-55	40	571	4	528	L-ascorbate oxidase OS=Cucurbita pepo var. melopepo OX=3665 PE=1 SV=1
sp|M4DUF2|ASO_BRARP	6.92e-54	36	563	17	539	L-ascorbate oxidase OS=Brassica rapa subsp. pekinensis OX=51351 GN=AO PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000170	0.999832	CS pos: 23-24. Pr: 0.9786

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1544_05965-t46_1-p1.