CAZyme Information: HMPREF1544_05699-t46_1-p1

Basic Information

• Species: Mucor circinelloides
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor circinelloides
• CAZyme ID: HMPREF1544_05699-t46_1-p1
• CAZy Family: GH37
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
553	KE123967|CGC1	61756.24	7.9857

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mcircinelloides1006PhL	12410	1220926	183	12227

• Gene Location: location=KE123967:75548-77325(+)

Full Sequence      

MKVANILLFGSWMLASIAAAAAVDETATFEVKDGYREPKNIAFMVMSGGASHTNWVLAFM
QELSANRGHKTYFITRDDHVKFGHSFPSVDTVSIGPTYEFDEKKIDIIKKMRERPMMESF
IDMFSSFNQEFGLDYTSIINTLTSKKIDLAICDHFCTPCVEASTKLKIPFIITSGMALGP
DAGAPYINNNILTISEPSTLNMSLWQRFDAMFIKPAQFIYKLRPFAKQQRALYTSLGIED
PVNVPEDRWKDSLKIVNSAFGFELARPLGPLVELVGPITTTRAPALTSELTQFMELHNKV
AYVAFGQHVVVSPKDIQLLLTGLLEAYEAQELDGIIWATRGLEGDFPDTLTTASNTVYHI
QSLFQGHGNKDIRFIQWAPQIAILNHPSTSMFITHGGAGSLFESLNAGVPVVVFPFFGDQ
PAAAKNAERSGFGMKLEHTEPQARATEIIRTVARDKDHHFRANVKRFQTLVQLNNKIGII
KAATLVEEVLFTHRHGQLLHRRDVKRDMSLFKAYNLDLYAVVLAVLAASLVGLTQLVKTA
LSNYHLKQKLKTH

Enzyme Prediction     

No EC number prediction in HMPREF1544_05699-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	281	468	2.4e-23	0.39790575916230364

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	2.28e-40	44	471	5	389	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
278624	UDPGT	2.12e-26	61	528	21	476	UDP-glucoronosyl and UDP-glucosyl transferase.
177813	PLN02152	1.47e-14	298	470	261	432	indole-3-acetate beta-glucosyltransferase
223071	egt	3.69e-14	253	466	248	441	ecdysteroid UDP-glucosyltransferase; Provisional
224732	YjiC	4.17e-14	377	490	291	399	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOC55050.1|GT1	2.43e-161	17	549	17	543
AOC55049.1|GT1	1.47e-104	38	550	33	538
CDS06891.1|GT1	3.70e-94	38	538	45	539
CDS06902.1|GT1	1.99e-92	38	519	39	514
CDS11218.1|GT1	1.09e-91	39	527	42	523

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2O6L_A	4.00e-11	363	470	55	167	Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens],2O6L_B Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens]
2PQ6_A	1.04e-10	300	478	297	463	Crystal structure of Medicago truncatula UGT85H2- Insights into the structural basis of a multifunctional (Iso) flavonoid glycosyltransferase [Medicago truncatula]
3WC4_A	1.26e-10	300	425	266	373	Crystal structure of UDP-glucose: anthocyanidin 3-O-glucosyltransferase from Clitoria ternatea [Clitoria ternatea],4REL_A Crystal structure of UDP-glucose: anthocyanidin 3-O-glucosyltransferase in complex with kaempferol [Clitoria ternatea],4REM_A Crystal structure of UDP-glucose: anthocyanidin 3-O-glucosyltransferase in complex with delphinidin [Clitoria ternatea],4REN_A Crystal structure of UDP-glucose: anthocyanidin 3-O-glucosyltransferase in complex with petunidin [Clitoria ternatea],4WHM_A Crystal structure of UDP-glucose: anthocyanidin 3-O-glucosyltransferase in complex with UDP [Clitoria ternatea]
3HBF_A	1.29e-10	275	420	245	377	Structure of UGT78G1 complexed with myricetin and UDP [Medicago truncatula],3HBJ_A Structure of UGT78G1 complexed with UDP [Medicago truncatula]
6IPB_A	1.49e-10	276	437	19	157	Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_B Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_C Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_D Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O02663|UD2B9_MACFA	2.70e-23	45	527	26	502	UDP-glucuronosyltransferase 2B9 OS=Macaca fascicularis OX=9541 GN=UGT2B9 PE=2 SV=1
sp|P06133|UD2B4_HUMAN	3.60e-23	51	535	34	510	UDP-glucuronosyltransferase 2B4 OS=Homo sapiens OX=9606 GN=UGT2B4 PE=1 SV=2
sp|O97951|UDB18_MACFA	1.55e-22	45	527	26	502	UDP-glucuronosyltransferase 2B18 OS=Macaca fascicularis OX=9541 GN=UGT2B18 PE=1 SV=1
sp|P16662|UD2B7_HUMAN	1.55e-22	45	527	26	502	UDP-glucuronosyltransferase 2B7 OS=Homo sapiens OX=9606 GN=UGT2B7 PE=1 SV=2
sp|Q9BY64|UDB28_HUMAN	2.07e-22	44	535	27	510	UDP-glucuronosyltransferase 2B28 OS=Homo sapiens OX=9606 GN=UGT2B28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000598	0.999372	CS pos: 20-21. Pr: 0.9698

TMHMM  Annotations     

Start	End
518	537