CAZyme Information: HMPREF1544_04662-t46_1-p1

Basic Information

• Species: Mucor circinelloides
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor circinelloides
• CAZyme ID: HMPREF1544_04662-t46_1-p1
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
262		28325.75	6.2320

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mcircinelloides1006PhL	12410	1220926	183	12227

• Gene Location: location=KE123949:120607-121629(+)

Full Sequence      

MYISNISLCAVALFSAVASAATLNQCSSGTTKFSEGLGSWTEERNMTKGWKITDQGLVMT
LEPPAKFVRMTNSSDGNLPYNKYASPTSTNFIYSTLMHYGSVSFDLKAAGKAGAVTAAVL
MAPGGDEIDFEMLGATTDKVQTNFFYGSNPIYNVNSVDSALTVNTASGFHNYTVNWTPEK
IEFYVDKKLIRTVVNKDDCNAKGDCTYPTHAATVQIGLWDSSAEAGTTQWARGPINWTSG
ETISATVRSVTVNCNPKYNNVK

Enzyme Prediction     

No EC number prediction in HMPREF1544_04662-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	74	235	1.7e-36	0.9425287356321839

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185692	GH16_fungal_CRH1_transglycosylase	3.60e-44	45	254	13	201	glycosylphosphatidylinositol-glucanosyltransferase. Group of fungal GH16 members related to Saccharomyces cerevisiae Crh1p. Chr1p and Crh2p are transglycosylases that are required for the linkage of chitin to beta(1-3)glucose branches of beta(1-6)glucan, an important step in the assembly of new cell wall. Both have been shown to be glycosylphosphatidylinositol (GPI)-anchored. A third homologous protein, Crr1p, functions in the formation of the spore wall. They belongs to the family 16 of glycosyl hydrolases that includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
395585	Glyco_hydro_16	1.54e-33	82	238	19	167	Glycosyl hydrolases family 16.
185683	Glyco_hydrolase_16	2.40e-20	47	234	10	199	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185685	GH16_XET	1.22e-15	98	240	47	189	Xyloglucan endotransglycosylase, member of glycosyl hydrolase family 16. Xyloglucan endotransglycosylases (XETs) cleave and religate xyloglucan polymers in plant cell walls via a transglycosylation mechanism. Xyloglucan is a soluble hemicellulose with a backbone of beta-1,4-linked glucose units, partially substituted with alpha-1,6-linked xylopyranose branches. It binds noncovalently to cellulose, cross-linking the adjacent cellulose microfibrils, giving it a key structural role as a matrix polymer. Therefore, XET plays an important role in all plant processes that require cell wall remodeling.
185684	GH16_lichenase	7.72e-12	98	250	67	208	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS13191.1|GH16	2.56e-64	26	261	29	263
CDS10243.1|GH16	8.70e-52	26	261	33	272
VWO96434.1|GH16	1.98e-28	50	254	849	1052
AFR92726.2|CBM18|GH16_19	6.10e-26	87	254	127	304
AUB22189.1|CBM18|GH16_19	6.10e-26	87	254	127	304

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IBU_A	3.44e-18	99	256	70	226	Apo Crh5 transglycosylase [Aspergillus fumigatus Af293],6IBU_B Apo Crh5 transglycosylase [Aspergillus fumigatus Af293],6IBW_A Crh5 transglycosylase in complex with NAG [Aspergillus fumigatus Af293],6IBW_B Crh5 transglycosylase in complex with NAG [Aspergillus fumigatus Af293]
2UWC_A	7.88e-10	99	225	61	191	Crystal structure of Nasturtium xyloglucan hydrolase isoform NXG2 [Tropaeolum majus],2UWC_B Crystal structure of Nasturtium xyloglucan hydrolase isoform NXG2 [Tropaeolum majus]
2UWA_A	8.05e-10	99	225	64	194	Crystal structure of the Nasturtium seedling xyloglucanase isoform NXG1 [Tropaeolum majus],2UWA_B Crystal structure of the Nasturtium seedling xyloglucanase isoform NXG1 [Tropaeolum majus],2UWA_C Crystal structure of the Nasturtium seedling xyloglucanase isoform NXG1 [Tropaeolum majus]
3D6E_A	1.17e-08	99	230	59	179	Crystal structure of the engineered 1,3-1,4-beta-glucanase protein from Bacillus licheniformis [Bacillus licheniformis],3D6E_B Crystal structure of the engineered 1,3-1,4-beta-glucanase protein from Bacillus licheniformis [Bacillus licheniformis]
3O5S_A	2.34e-08	126	230	128	216	Crystal Structure of the endo-beta-1,3-1,4 glucanase from Bacillus subtilis (strain 168) [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4B4J2|CRH12_ARTBC	2.47e-25	85	237	86	234	Probable extracellular glycosidase ARB_03382 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03382 PE=3 SV=2
sp|Q5AJC0|UTR2_CANAL	7.93e-23	34	239	95	282	Extracellular glycosidase UTR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=UTR2 PE=1 SV=1
sp|Q4WI46|CRF2_ASPFU	1.01e-20	75	254	112	300	Probable glycosidase crf2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=crf2 PE=1 SV=1
sp|Q05790|CRR1_YEAST	6.20e-18	73	252	163	351	Probable glycosidase CRR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CRR1 PE=2 SV=1
sp|P32623|CRH2_YEAST	7.38e-18	99	254	138	300	Probable glycosidase CRH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UTR2 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000239	0.999755	CS pos: 20-21. Pr: 0.9724

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1544_04662-t46_1-p1.