CAZyme Information: HMPREF1544_04107-t46_1-p1

Basic Information

• Species: Mucor circinelloides
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor circinelloides
• CAZyme ID: HMPREF1544_04107-t46_1-p1
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
440		49565.61	5.6149

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mcircinelloides1006PhL	12410	1220926	183	12227

• Gene Location: location=KE123940:158692-160014(-)

Full Sequence      

MTDVFSNAKNSTLRRVRLKPSLPNSLMLYSASNCYLNSTPINNFVLPPPPPPCVAPSSCS
SIAKSASRVLKPSLRKLGPLCSEANAIIKSVHFNEPLTRVVHFYTPPPLDEYDEDDEEET
EEEEEEEEEEEGKLEDAFLELYLTKSLQDECDSLAIADAPTTKNDGLSLPNWPLSTHPTR
RFISQMVSLESVAWNHSLQVVQGRVLVHNLVFEKKVTARCSFDGWKTWIDVDAYHKEPAF
NKLSESNSAFDRFMFELHVPENTHEFNCDIAIRYQTLGQEFWDNNNGNNFTIQSTPLRSK
KSGEEPLSSFAAMMQVHGNSSNSNIKEGLSIISRLNFMEYDGKGSNQRQEKMKESCKHVH
IVSQAKNTAKNRHSKYGASKIPAAPIPTRKRSTVQQQQNMDAPLVVVDLSQQQTGNSNDA
LISIMNTHDEAIDLKEKLYV

Enzyme Prediction     

No EC number prediction in HMPREF1544_04107-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM21	185	292	6.4e-27	0.9719626168224299

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397445	CBM_21	1.13e-30	181	293	1	113	Carbohydrate/starch-binding module (family 21). This family consists of several eukaryotic proteins that are thought to be involved in the regulation of glycogen metabolism. For instance, the mouse PTG protein has been shown to interact with glycogen synthase, phosphorylase kinase, phosphorylase a: these three enzymes have key roles in the regulation of glycogen metabolism. PTG also binds the catalytic subunit of protein phosphatase 1 (PP1C) and localizes it to glycogen. Subsets of similar interactions have been observed with several other members of this family, such as the yeast PIG1, PIG2, GAC1 and GIP2 proteins. While the precise function of these proteins is not known, they may serve a scaffold function, bringing together the key enzymes in glycogen metabolism. This family is a carbohydrate binding domain.
407028	CBM53	5.98e-14	209	292	1	75	Starch/carbohydrate-binding module (family 53).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS20396.1|CBM21	1.70e-15	166	307	304	442
EAA64131.1|CBM21	2.45e-14	166	307	420	558
CDS05148.1|CBM21	2.58e-13	170	352	129	306
QPG75041.1|CBM21	6.79e-13	187	303	332	458
AAL39375.1|CBM21	7.56e-13	185	303	20	133

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2EEF_A	7.52e-13	199	308	46	151	Chain A, Protein phosphatase 1, regulatory (Inhibitor) subunit 3B [Homo sapiens]
2M83_A	1.02e-08	185	292	30	133	Solution structure of the carbohydrate binding module of the muscle glycogen-targeting subunit of Protein Phosphatase-1 [Oryctolagus cuniculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9VVY3|GBS76_DROME	3.62e-12	185	303	529	642	Glycogen-binding subunit 76A OS=Drosophila melanogaster OX=7227 GN=Gbs-76A PE=1 SV=1
sp|Q7TMB3|PPR3C_MOUSE	3.84e-12	143	292	122	256	Protein phosphatase 1 regulatory subunit 3C OS=Mus musculus OX=10090 GN=Ppp1r3c PE=1 SV=1
sp|Q6IN01|PPR3B_RAT	5.03e-12	199	306	142	245	Protein phosphatase 1 regulatory subunit 3B OS=Rattus norvegicus OX=10116 GN=Ppp1r3b PE=1 SV=1
sp|Q8C767|PPR3B_MOUSE	1.23e-11	199	306	142	245	Protein phosphatase 1 regulatory subunit 3B OS=Mus musculus OX=10090 GN=Ppp1r3b PE=1 SV=1
sp|A6QNP3|PPR3B_BOVIN	2.22e-11	201	306	144	245	Protein phosphatase 1 regulatory subunit 3B OS=Bos taurus OX=9913 GN=PPP1R3B PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000086	0.000000

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1544_04107-t46_1-p1.