CAZyme Information: HMPREF1544_03901-t46_1-p1

Basic Information

• Species: Mucor circinelloides
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor circinelloides
• CAZyme ID: HMPREF1544_03901-t46_1-p1
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1041	KE123937|CGC2	119124.49	6.6297

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mcircinelloides1006PhL	12410	1220926	183	12227

• Gene Location: location=KE123937:85902-89142(-)

Full Sequence      

MSDMAPLFSLFAIIPVVLGGFYFYAHQRTFGHLDITTSSVAYNRTRYHDRLDWDKYALTI
EGEPTQIHSGEFHYWRVPDRERWSPILKQYRAAGFNTIRIYFHWGYHSPAEGVYNFDGNR
DIEYLLNLCEELNLFVLAAPGPYICAETQAGGYPGWLVSKRDLNIRHNYIMLWRVYDQKF
AEYEIQWLNHILPIIARHQITENKADKKGCVLGLQIDNELFETMANLLPIGLHDQMRVLA
KAARDAGITVPLFSNDGFEEGGWVPRPELDNQKKKKFWSRDRFGLDLYGFDKYVIFAPSS
SPKSWLIDSGVSVASWDDWNPKNMENSMDRLEKTVRGFGGGAKESPMFIPELQGGWFNHY
QLQHTYDHIYDYYGDEYTKLLVETSLAQGVTMASVYMIYGGTNWGTLGDPDVYTSYDYSA
CIREFGMLSSRGRNLRKTILLTRSFDPYFTKTERVEKPNVKTSIPHTMNLQRSSVGSDQD
VVFTFFRNFDRQKRETFDVTVDETTGSFTMGCYLPYKTSFIAVGNYTAQNDLHLILSTIP
ILTRIVHKEAKEEVWIVEPNIVGAMAFANKEVKVTGNMQDDVLRTEGPAVILTFEKDNGW
TKIETATGSLYIIGLNRKDAGTLFAEFEEPYWNHGVKKYPALAAWGADNFYYDKKTQKLD
VNHRRSETAAHIVSFGDVADSHATLATDRYDIPVVKYAEFNNKPVKPVSIEPSHWEQRSV
DFKSLPWEKLKSFKENGSTTFNAIDYHYTSGHVLYRAVFKTPDSEHPRVSLSLNARNRAT
VLVNGHVVGGHTTYSRQLFMPGAKIGPDPFFLGKHKYDLTPYLSHSDSLENQLVVLVESF
GLNRQAFIMNDIRNPRGIVSADIHGLKEKPEWEVAGVDVRTLSNPFSSTGFPDENAAGYK
KYSQVDMTSKKSVSIPISVDQGVQWFRFRFDNEHKKSISSYNVPLRLHLDGEWTAMVFVN
DVFIARYYGNGDGPQHDFYLPDDLIQAKNNQVKILAYTWKDTEAKLSIAGWPVLADSGNL
ITHETEEKPAEYLIYKDHIKL

Enzyme Prediction     

No EC number prediction in HMPREF1544_03901-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	58	438	7.2e-76	0.9869706840390879

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396048	Glyco_hydro_35	9.57e-55	57	426	1	302	Glycosyl hydrolases family 35.
166698	PLN03059	1.23e-18	53	450	32	357	beta-galactosidase; Provisional
224786	GanA	2.92e-18	54	219	4	160	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
396834	Glyco_hydro_42	7.37e-06	79	220	8	138	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS09169.1|GH35	0.0	5	1041	3	1033
UPG93009.1|GH35	1.12e-76	51	1018	39	933
QYN54214.1|GH35	6.54e-73	50	1006	43	942
QYN56074.1|GH35	2.18e-72	50	1006	43	942
UPG88513.1|GH35	1.06e-71	36	1018	27	936

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1TG7_A	2.71e-43	51	1020	6	956	Native structure of beta-galactosidase from Penicillium sp. [Penicillium sp.],1XC6_A Native Structure Of Beta-Galactosidase from Penicillium sp. in complex with Galactose [Penicillium sp.]
5IFP_A	3.06e-43	51	988	46	955	Structure Of Beta-galactosidase From Aspergillus Niger [Aspergillus niger CBS 513.88]
5IFT_A	7.06e-43	51	988	46	955	STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 3-b-Galactopyranosyl glucose [Aspergillus niger CBS 513.88],5IHR_A Structure Of E298q-beta-galactosidase From Aspergillus Niger In Complex With Allolactose [Aspergillus niger CBS 513.88],5JUV_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-b-Galactopyranosyl galactose [Aspergillus niger CBS 513.88],5MGC_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 4-Galactosyl-lactose [Aspergillus niger CBS 513.88],5MGD_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-Galactosyl-lactose [Aspergillus niger CBS 513.88]
4IUG_A	2.60e-41	44	1029	39	996	Crystal structure of beta-galactosidase from Aspergillus oryzae in complex with galactose [Aspergillus oryzae]
3OG2_A	4.51e-41	51	424	26	350	Chain A, Beta-galactosidase [Trichoderma reesei],3OGR_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGS_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGV_A Chain A, Beta-galactosidase [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A7EBU5|BGALB_SCLS1	1.04e-52	50	529	36	476	Probable beta-galactosidase B OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) OX=665079 GN=lacB PE=3 SV=1
sp|A1DM65|BGALC_NEOFI	1.23e-52	51	1006	32	948	Probable beta-galactosidase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=lacC PE=3 SV=1
sp|Q4WNE4|BGALC_ASPFU	2.90e-52	51	1006	32	948	Probable beta-galactosidase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=lacC PE=3 SV=1
sp|B0Y752|BGALC_ASPFC	2.90e-52	51	1006	32	948	Probable beta-galactosidase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=lacC PE=3 SV=1
sp|A6RPN7|BGALB_BOTFB	7.67e-52	50	529	36	476	Probable beta-galactosidase B OS=Botryotinia fuckeliana (strain B05.10) OX=332648 GN=lacB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999978	0.000071

TMHMM  Annotations     

Start	End
7	26