CAZyme Information: HMPREF1544_03739-t46_1-p1

Basic Information

• Species: Mucor circinelloides
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor circinelloides
• CAZyme ID: HMPREF1544_03739-t46_1-p1
• CAZy Family: GH17
• CAZyme Description: glycogen [starch] synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
691		79320.25	6.0349

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mcircinelloides1006PhL	12410	1220926	183	12227

• Gene Location: location=KE123935:7259-9703(+)

Full Sequence      

MTTVQRDVYNPLLFEIAWEVANKVGGIYTVIKTKVPVTVREFGDRYTLIGPLSYKTAPME
VEACEPANEKMKEVLDSMSQYGVKYLYGRWLVEGSPYVLLFDTGSVLNKLDEWKGDLWRS
AGIPSPPHDTETNDAILFGYLVTWFLGELTPKYNKSGDPAIICHFHEWLAGVAVPLIKKR
HLDVCTIFTTHATLLGRYLCAGSVDFYNNLANFDVDEEAGKRGIYHRYCIERGAAHCADV
FTTVSHITAYESEHLLKRKPDGVLPNGLNVVKFSAMHEFQNLHALSKEKINDFVRGHFYG
HYDFDLDNTIYIFTAGRYEYRNKGVDMFVESLARLNARLKSSGSKMTVVAFLIMPTATHS
FNVEALKGQAVTRQLRTTVSEIQDRVGKAIYENALRLEDINPTNFLSDADKVLLKRRVFA
LKRTTLPPIVTHNIVDDSKDPVLNQLRRLNMFNNSDDRVKIVFHPEFLNANNPLIGMDYE
EFVRGCHLGVFPSYYEPWGYTPAECTVMGVPSITTNLSGFGCFMEENIENCDDYGIYITD
RRMKSVEDSLQQLCDQMYQFVQKTRRQRINQRNRTERLSDLLDWKRMGLEYIKARQLALR
RAYPDSFIDDDEEELLSDAPVKIPKPLSAPASPRLRMEVNNMFNDDEEEEDFLFPALRRK
NQVQTREQELLSEGDIEAFNKLTLENKEAHH

Enzyme Prediction     

EC	2.4.1.11:48

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT3	15	638	4.3e-295	0.9811616954474097

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340824	GT3_GSY2-like	0.0	10	601	1	590	glycogen synthase GSY2 and similar proteins. Glycogen synthase, which is most closely related to the GT3 family of glycosyltransferases, catalyzes the transfer of a glucose molecule from UDP-glucose to a terminal branch of a glycogen molecule, a rate-limit step of glycogen biosynthesis. GSY2, the member of this family in S. cerevisiae, has been shown to possess glycogen synthase activity.
399009	Glycogen_syn	0.0	15	634	1	617	Glycogen synthase. This family consists of the eukaryotic glycogen synthase proteins GYS1, GYS2 and GYS3. Glycogen synthase (GS) is the enzyme responsible for the synthesis of -1,4-linked glucose chains in glycogen. It is the rate limiting enzyme in the synthesis of the polysaccharide, and its activity is highly regulated through phosphorylation at multiple sites and also by allosteric effectors, mainly glucose 6-phosphate (G6P).
340816	Glycosyltransferase_GTB-type	2.80e-08	417	520	130	222	glycosyltransferase family 1 and related proteins with GTB topology. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. The structures of the formed glycoconjugates are extremely diverse, reflecting a wide range of biological functions. The members of this family share a common GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
404341	Glyco_transf_4	1.34e-04	155	270	69	168	Glycosyltransferase Family 4.
223515	RfaB	4.55e-04	161	340	87	229	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS05411.1|GT3	0.0	5	687	3	702
CBQ70430.1|GT3	0.0	2	634	4	642
SAM76392.1|GT3	0.0	5	634	9	644
SJX61105.1|GT3	0.0	2	634	4	642
CDU24579.1|GT3	0.0	5	634	7	642

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6U77_A	8.01e-299	4	634	1	657	yGsy2p in complex with small molecule [Saccharomyces cerevisiae S288C],6U77_B yGsy2p in complex with small molecule [Saccharomyces cerevisiae S288C],6U77_C yGsy2p in complex with small molecule [Saccharomyces cerevisiae S288C],6U77_D yGsy2p in complex with small molecule [Saccharomyces cerevisiae S288C]
5UX7_A	1.37e-298	4	634	21	677	Activated state yeast Glycogen Synthase in complex with UDP-xylose [Saccharomyces cerevisiae S288C],5UX7_B Activated state yeast Glycogen Synthase in complex with UDP-xylose [Saccharomyces cerevisiae S288C],5UX7_C Activated state yeast Glycogen Synthase in complex with UDP-xylose [Saccharomyces cerevisiae S288C],5UX7_D Activated state yeast Glycogen Synthase in complex with UDP-xylose [Saccharomyces cerevisiae S288C]
5SUK_A	1.64e-298	4	634	21	677	G6P bound activated state of yeast glycogen synthase 2 [Saccharomyces cerevisiae S288C],5SUK_B G6P bound activated state of yeast glycogen synthase 2 [Saccharomyces cerevisiae S288C],5SUK_C G6P bound activated state of yeast glycogen synthase 2 [Saccharomyces cerevisiae S288C],5SUK_D G6P bound activated state of yeast glycogen synthase 2 [Saccharomyces cerevisiae S288C]
4KQM_A	3.18e-298	3	634	19	676	Crystal structure of yeast glycogen synthase E169Q mutant in complex with glucose and UDP [Saccharomyces cerevisiae FostersO],4KQM_B Crystal structure of yeast glycogen synthase E169Q mutant in complex with glucose and UDP [Saccharomyces cerevisiae FostersO],4KQM_C Crystal structure of yeast glycogen synthase E169Q mutant in complex with glucose and UDP [Saccharomyces cerevisiae FostersO],4KQM_D Crystal structure of yeast glycogen synthase E169Q mutant in complex with glucose and UDP [Saccharomyces cerevisiae FostersO]
5UW0_A	3.91e-298	4	634	21	677	Chain A, Glycogen [starch] synthase isoform 2 [Saccharomyces cerevisiae S288C],5UW0_B Chain B, Glycogen [starch] synthase isoform 2 [Saccharomyces cerevisiae S288C],5UW0_C Chain C, Glycogen [starch] synthase isoform 2 [Saccharomyces cerevisiae S288C],5UW0_D Chain D, Glycogen [starch] synthase isoform 2 [Saccharomyces cerevisiae S288C],5UW1_A Activated state yGsy2p in complex with UDP-galactose [Saccharomyces cerevisiae S288C],5UW1_B Activated state yGsy2p in complex with UDP-galactose [Saccharomyces cerevisiae S288C],5UW1_C Activated state yGsy2p in complex with UDP-galactose [Saccharomyces cerevisiae S288C],5UW1_D Activated state yGsy2p in complex with UDP-galactose [Saccharomyces cerevisiae S288C],5UW4_A Chain A, Glycogen [starch] synthase isoform 2 [Saccharomyces cerevisiae S288C],5UW4_B Chain B, Glycogen [starch] synthase isoform 2 [Saccharomyces cerevisiae S288C],5UW4_C Chain C, Glycogen [starch] synthase isoform 2 [Saccharomyces cerevisiae S288C],5UW4_D Chain D, Glycogen [starch] synthase isoform 2 [Saccharomyces cerevisiae S288C],5VNC_A Chain A, Glycogen [starch] synthase isoform 2 [Saccharomyces cerevisiae S288C],5VNC_B Chain B, Glycogen [starch] synthase isoform 2 [Saccharomyces cerevisiae S288C],5VNC_C Chain C, Glycogen [starch] synthase isoform 2 [Saccharomyces cerevisiae S288C],5VNC_D Chain D, Glycogen [starch] synthase isoform 2 [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O93869|GYS_NEUCR	0.0	6	636	9	640	Glycogen [starch] synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=gsy-1 PE=2 SV=2
sp|P23337|GYS1_YEAST	3.09e-308	6	636	3	659	Glycogen [starch] synthase isoform 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GSY1 PE=1 SV=3
sp|P27472|GYS2_YEAST	2.91e-298	4	634	1	657	Glycogen [starch] synthase isoform 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GSY2 PE=1 SV=3
sp|P13834|GYS1_RABIT	4.43e-278	7	649	23	662	Glycogen [starch] synthase, muscle OS=Oryctolagus cuniculus OX=9986 GN=GYS1 PE=1 SV=4
sp|Q9Z1E4|GYS1_MOUSE	6.98e-278	7	649	23	662	Glycogen [starch] synthase, muscle OS=Mus musculus OX=10090 GN=Gys1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000018	0.000000

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1544_03739-t46_1-p1.