CAZyme Information: HMPREF1544_03523-t46_1-p1

Basic Information

• Species: Mucor circinelloides
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor circinelloides
• CAZyme ID: HMPREF1544_03523-t46_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
406		46319.72	6.6140

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mcircinelloides1006PhL	12410	1220926	183	12227

• Gene Location: location=KE123932:11312-12532(-)

Full Sequence      

MTSTLSPTNAHYMNPMLHQYRKRVMLKRSTHQINDPVVVQQKYTSNKKSVRFHDDRDQLE
QVRYFFKTQSPITVKSDPPFMDSSADDYKLTQPNWPTRNQIFYNTESKIRMEAVQLMDGD
VEHMAENKFIIQGRCRAANLSFRKLVSIRYTFDLWRTYSETTGEYRESIASTSNTWDRFY
FSIPIEAKQTTQTIYLALRYTVDDQEYWDNNNGMNYQIIMTPDESILDTKHTDTNSITLM
DEKEQALTPITATTSTTTTTSTTSTTSSTATNTSPLPFITETTTQEKKEATKVLGRRYDF
TASLTAARKPMSPPPSPPGTPVDTEVFNYTPPVFFGDSYQFEVAPAVTYQKSEPIAIASK
PPASPPISAEGFQMSYSDFVNKYCFYNSHSNPIYSTFSTSPSAVLS

Enzyme Prediction     

No EC number prediction in HMPREF1544_03523-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM21	126	218	2e-26	0.8691588785046729

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397445	CBM_21	4.07e-30	106	218	4	112	Carbohydrate/starch-binding module (family 21). This family consists of several eukaryotic proteins that are thought to be involved in the regulation of glycogen metabolism. For instance, the mouse PTG protein has been shown to interact with glycogen synthase, phosphorylase kinase, phosphorylase a: these three enzymes have key roles in the regulation of glycogen metabolism. PTG also binds the catalytic subunit of protein phosphatase 1 (PP1C) and localizes it to glycogen. Subsets of similar interactions have been observed with several other members of this family, such as the yeast PIG1, PIG2, GAC1 and GIP2 proteins. While the precise function of these proteins is not known, they may serve a scaffold function, bringing together the key enzymes in glycogen metabolism. This family is a carbohydrate binding domain.
407028	CBM53	5.54e-11	139	218	1	75	Starch/carbohydrate-binding module (family 53).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS05148.1|CBM21	1.36e-48	48	403	88	387
CDS02860.1|CBM21	2.33e-38	43	312	60	306
CAE7188260.1|CBM21	2.02e-20	48	401	255	632
BAK05214.1|CBM21	2.70e-20	48	218	255	432
CBX97277.1|CBM21	3.78e-20	48	221	255	435

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2EEF_A	1.47e-11	131	219	48	136	Chain A, Protein phosphatase 1, regulatory (Inhibitor) subunit 3B [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7TMB3|PPR3C_MOUSE	1.99e-10	131	219	169	257	Protein phosphatase 1 regulatory subunit 3C OS=Mus musculus OX=10090 GN=Ppp1r3c PE=1 SV=1
sp|T1SFR8|PPR3C_CLABA	2.77e-10	131	233	153	255	Protein phosphatase 1 regulatory subunit 3C OS=Clarias batrachus OX=59899 GN=PPP1R3C PE=2 SV=1
sp|Q86XI6|PPR3B_HUMAN	5.00e-10	131	219	145	233	Protein phosphatase 1 regulatory subunit 3B OS=Homo sapiens OX=9606 GN=PPP1R3B PE=1 SV=1
sp|Q6P950|PR3CB_DANRE	6.42e-10	131	225	170	264	Protein phosphatase 1 regulatory subunit 3C-B OS=Danio rerio OX=7955 GN=ppp1r3cb PE=2 SV=1
sp|Q0VCR4|PPR3C_BOVIN	8.65e-10	121	219	159	257	Protein phosphatase 1 regulatory subunit 3C OS=Bos taurus OX=9913 GN=PPP1R3C PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000051	0.000000

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1544_03523-t46_1-p1.