CAZyme Information: HMPREF1544_03333-t46_1-p1

Basic Information

• Species: Mucor circinelloides
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor circinelloides
• CAZyme ID: HMPREF1544_03333-t46_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
537	KE123929|CGC1	60249.65	5.1696

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mcircinelloides1006PhL	12410	1220926	183	12227

• Gene Location: location=KE123929:47639-49314(+)

Full Sequence      

MSAKEISFRDDNIQYFGRWHTSTNDIQSGWPGAYFRVILEHTTFVQLQLSTPTSIQVQID
KGPHFDFINITHINIQQGLEQEGPHELKVIATDTDPTHLSVRLQSILLDETGITLPPAPS
ADTPLVEFVGHDLTLGLETSQRLFSSFAWLTSDLLGLEHSHIAYKDATLIDGMESKYFDW
SLLLDQEQQQQTTTKTPWSVVILLGSNDHQTDYASDEYRDALNTFLAKLRKTLYENAPIF
ILSEPLGDMFRPSQQSVLDMTHQGDQYIYFIDTTGWLRYGPNYYRDRSHLTDAGHELLAK
KLAPLLQVKLTHPRDPLPGPPPNPNLPGDWQTMDVGQENRIGLPGTVSADSASTFTLWGS
GADIDNDTDAFRFVYQPFSNQGTIESTVRSHSAFAKCAKAGIMIREHLGHGSPLIMLGIS
PAEGIFVQIRYGNFESTKLIKKMRASPPYRLRLVRQKQNNIFEAQIQHVDSGGNDANWET
FASVPFVMARDVYAGIAVTSCDTSVVSVAKFTEVALYHSASLTLQDNVHFIDQQQFE

Enzyme Prediction     

No EC number prediction in HMPREF1544_03333-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE2	144	304	4.4e-18	0.8373205741626795

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238869	Endoglucanase_E_like	4.65e-12	126	296	2	158	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
404371	Lipase_GDSL_2	6.88e-06	200	296	65	175	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238863	SGNH_hydrolase_peri1	0.008	200	245	60	105	SGNH_peri1; putative periplasmic member of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATB41364.1|CBM42|CBM66|CE0	4.22e-33	10	360	43	396
ATB28301.1|CBM42|CBM66|CE0	5.67e-33	10	304	42	342
ACU62289.1|CBM13|CE2	2.44e-32	7	306	48	351
AXE84186.1|CE2	1.30e-30	2	366	37	409
AEV97647.1|CE2	3.70e-30	10	311	56	360

PDB Hits     

HMPREF1544_03333-t46_1-p1 has no PDB hit.

Swiss-Prot Hits     

HMPREF1544_03333-t46_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000039	0.000017

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1544_03333-t46_1-p1.