CAZyme Information: HMPREF1544_03197-t46_1-p1

Basic Information

• Species: Mucor circinelloides
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor circinelloides
• CAZyme ID: HMPREF1544_03197-t46_1-p1
• CAZy Family: GH152
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
421		49365.85	7.4728

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mcircinelloides1006PhL	12410	1220926	183	12227

• Gene Location: location=KE123927:75223-76599(+)

Full Sequence      

MSADLQSFMGRRGVKAMGLVLLLSCLALLAKYYTYEPNSSHFRRALFYRNDSSIQQGQFN
SHFSWTDGNGGLHQLPIETVLSKSFSLSSYSEQSQIIPYYYKSAMNMTGEDITIVTLVTR
NRIPNLARLATQYQGPISTTIHISDDDEGEYTLELLQKAMDKNPNMRKFVDVHVVRDEFD
RELNLWRNVAKLFARTEYVMQLDIDFFPCTDIRKSVLNNPKAMDLLRSGEAALVIPAFEY
SKQEEGLDYRHFPTNKPDLVKQYNDNKVEMFHSFWLPGHAPTDYERWTSNEKEIYKVTTY
QHSYEPYVIFKNQGSPWCDERFAGYGSNKAACLYELYISGVDYYVLPNDFIVHQTHAYPD
EARQVERYYNRRLYTQFREEICIRLARRFITQKKWDQPKSENLRQECASIKPFQRAIGRF
V

Enzyme Prediction     

No EC number prediction in HMPREF1544_03197-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT49	96	388	6.3e-47	0.8456973293768546

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404735	Glyco_transf_49	2.42e-59	111	384	1	325	Glycosyl-transferase for dystroglycan. This glycosyl-transferase brings about the glycosylation of the alpha-dystroglycan subunit. Dystroglycan is an integral member of the skeletal muscular dystrophin glycoprotein complex, which links dystrophin to proteins in the extracellular matrix.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS09884.1|GT49	8.61e-138	45	418	26	391
CDS10115.1|GT49	3.09e-137	43	418	55	427
CDS06217.1|GT49	5.92e-136	55	417	71	431
CDS06289.1|GT49	3.93e-134	94	419	99	423
CDS14203.1|GT49	1.31e-130	60	419	66	426

PDB Hits     

HMPREF1544_03197-t46_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q66PG2|LARG1_DANRE	1.37e-27	100	357	463	710	Xylosyl- and glucuronyltransferase LARGE1 OS=Danio rerio OX=7955 GN=large1 PE=2 SV=1
sp|O95461|LARG1_HUMAN	1.09e-26	99	357	463	709	Xylosyl- and glucuronyltransferase LARGE1 OS=Homo sapiens OX=9606 GN=LARGE1 PE=1 SV=1
sp|Q54PG8|GNT14_DICDI	1.20e-26	112	402	348	633	Glycosyltransferase-like protein gnt14 OS=Dictyostelium discoideum OX=44689 GN=gnt14 PE=2 SV=1
sp|Q9Z1M7|LARG1_MOUSE	8.62e-26	100	357	462	709	Xylosyl- and glucuronyltransferase LARGE1 OS=Mus musculus OX=10090 GN=Large1 PE=1 SV=1
sp|Q66PG3|LARG1_CHICK	1.16e-25	99	357	463	709	Xylosyl- and glucuronyltransferase LARGE1 OS=Gallus gallus OX=9031 GN=LARGE1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000009	0.000001

TMHMM  Annotations     

Start	End
13	35