CAZyme Information: HMPREF1544_02760-t46_1-p1

Basic Information

• Species: Mucor circinelloides
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor circinelloides
• CAZyme ID: HMPREF1544_02760-t46_1-p1
• CAZy Family: CE4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
465		53247.48	8.1455

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mcircinelloides1006PhL	12410	1220926	183	12227

• Gene Location: location=KE123921:98946-100453(-)

Full Sequence      

MDTVPTKKGLSGGVNQINSWFDQLLPQSSLLPHQHQQQQQESTKHTILKSRWFRLSIVVY
ILFSILLTAAHVTSWLFSGSSSSHYYHTSRSARDALSYQRTYDAEEAYSLLSNMSHGLKM
SKLFAQGHYDALKYVQPFWQRATNVPESQQVSFIVTTTPNTWKDLVQMAKNWNGPISATL
HISSKNDKNVLATIEAEYKSKPELFENVDLHLVETPNGIEKMASIMVPVNVERNLARIYA
RTDHVSDVPFNIIIATDLRQTLEKNQAKYTQLLSQGDMLVIPTFKYDDQQQLNQLQIPQT
KKELVGLVEGEHLLGLYDAHFELNQGPTDFKKWKKADALYAVTDYTMDYEPVVIQSKTVQ
PWCSERFVDKKSACLLSSYLAGNDFLVLPNDFAIQKPSNKNTAISDLDSVIEKRLYSKFY
WEQCVYHGRQLDAMGLWNSKKSEHIRQQCSRVIQNWGRGLIGKPE

Enzyme Prediction     

No EC number prediction in HMPREF1544_02760-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT49	140	416	2e-27	0.7952522255192879

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404735	Glyco_transf_49	2.76e-21	165	422	16	321	Glycosyl-transferase for dystroglycan. This glycosyl-transferase brings about the glycosylation of the alpha-dystroglycan subunit. Dystroglycan is an integral member of the skeletal muscular dystrophin glycoprotein complex, which links dystrophin to proteins in the extracellular matrix.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS07474.1|GT49	3.85e-136	14	465	79	525
CDS11928.1|GT49	1.36e-135	24	465	78	510
CDS06192.1|GT49	8.74e-64	109	455	129	477
CDS14416.1|GT49	1.55e-63	109	453	128	482
CDS09884.1|GT49	2.45e-51	113	452	50	383

PDB Hits     

HMPREF1544_02760-t46_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8N3Y3|LARG2_HUMAN	1.93e-08	146	428	427	702	Xylosyl- and glucuronyltransferase LARGE2 OS=Homo sapiens OX=9606 GN=LARGE2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999930	0.000075

TMHMM  Annotations     

Start	End
55	77