CAZyme Information: HMPREF1544_02736-t46_1-p1

Basic Information

• Species: Mucor circinelloides
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor circinelloides
• CAZyme ID: HMPREF1544_02736-t46_1-p1
• CAZy Family: CE4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
545	KE123921|CGC2	62325.64	6.8499

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mcircinelloides1006PhL	12410	1220926	183	12227

• Gene Location: location=KE123921:26292-27983(+)

Full Sequence      

MPGPKITAVQGDIVRVLIRNQLSPMPKKDDHRHNVAIHFHGIRQYGSVHSDGVPYLTQMP
IKPGQEFVHEFRIVNQAGTYFYHAHVGLQEETVFGPIVVYESKHADPENNNANISSLLKA
GPYTYHDERTLLLSEWWHRPHMEFEKFLMGPKFNFIPEADSILINGHTLHDSRKAVVAQC
GGYELVPVKPNQTYRFRVIGATAFRTLGFAIAHHNLTIIEVDGELTKPYTVSQLEVAPGQ
RFSVLVHTDQAWDDYSIQVVRRWSDNVPRPTNGLAILQYPQPSGRSDEHESRGVVRLKRP
IVLDPPRIKPHFEKAEDEQPYWLWSDIEPLHGVDPVIYKPATRTIKLRSVDQRMPDNTVR
WLVNGIAFSEEHSKDSPILHDIKSNRRQLPGLYDTITSNGYDRNLGTYPISYFDIVDIVI
QTTHKPGEPCRSHPWHTHGHSHWEIAHGQGEYVHERDADIQNVKNPIQKDITMIYPFIDP
DLFEKNGTKVEEPVGCGWSKIRLVADNPGVWAVHCHNTAHMLMGMMVALEEAPELIPRYS
NMNQI

Enzyme Prediction     

No EC number prediction in HMPREF1544_02736-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA1	1	525	3.8e-93	0.946927374301676

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
274555	ascorbase	1.49e-92	2	536	30	528	L-ascorbate oxidase, plant type. Members of this protein family are the copper-containing enzyme L-ascorbate oxidase (EC 1.10.3.3), also called ascorbase. This family is found in flowering plants, and shows greater sequence similarity to a family of laccases (EC 1.10.3.2) from plants than to other known ascorbate oxidases.
132431	ascorbOXfungal	2.62e-82	2	525	37	525	L-ascorbate oxidase, fungal type. This model describes a family of fungal ascorbate oxidases, within a larger family of multicopper oxidases that also includes plant ascorbate oxidases (TIGR03388), plant laccases and laccase-like proteins (TIGR03389), and related proteins. The member from Acremonium sp. HI-25 is characterized.
215324	PLN02604	1.00e-81	2	534	53	549	oxidoreductase
177843	PLN02191	3.76e-79	2	536	52	551	L-ascorbate oxidase
274556	laccase	8.18e-62	2	528	32	516	laccase, plant. Members of this protein family include the copper-containing enzyme laccase (EC 1.10.3.2), often several from a single plant species, and additional, uncharacterized, closely related plant proteins termed laccase-like multicopper oxidases. This protein family shows considerable sequence similarity to the L-ascorbate oxidase (EC 1.10.3.3) family. Laccases are enzymes of rather broad specificity, and classification of all proteins scoring about the trusted cutoff of this model as laccases may be appropriate.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS06185.1|AA1	1.14e-218	1	542	45	576
CDS06551.1|AA1	1.98e-133	2	539	56	648
CDS12532.1|AA1	1.21e-132	2	536	58	573
CDS07261.1|AA1	5.43e-99	2	502	53	518
CAA7401729.1|AA1	1.35e-68	2	538	62	558

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1AOZ_A	6.26e-66	2	538	32	530	Refined Crystal Structure Of Ascorbate Oxidase At 1.9 Angstroms Resolution [Cucurbita pepo var. melopepo],1AOZ_B Refined Crystal Structure Of Ascorbate Oxidase At 1.9 Angstroms Resolution [Cucurbita pepo var. melopepo],1ASO_A X-Ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-Forms [Cucurbita pepo var. melopepo],1ASO_B X-Ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-Forms [Cucurbita pepo var. melopepo],1ASP_A X-ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-forms [Cucurbita pepo var. melopepo],1ASP_B X-ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-forms [Cucurbita pepo var. melopepo],1ASQ_A X-Ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-Forms [Cucurbita pepo var. melopepo],1ASQ_B X-Ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-Forms [Cucurbita pepo var. melopepo]
1HFU_A	2.07e-40	36	531	62	468	Chain A, LACCASE 1 [Coprinopsis cinerea]
1A65_A	2.10e-40	36	531	62	468	Chain A, Laccase [Coprinopsis cinerea]
3X1B_A	6.93e-40	2	531	53	491	Crystal structure of laccase from Lentinus sp. at 1.8 A resolution [Lentinus],3X1B_B Crystal structure of laccase from Lentinus sp. at 1.8 A resolution [Lentinus]
2QT6_A	2.69e-37	2	545	32	479	Chain A, Laccase [Lentinus tigrinus],2QT6_B Chain B, Laccase [Lentinus tigrinus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P14133|ASO_CUCSA	2.90e-71	2	536	67	564	L-ascorbate oxidase OS=Cucumis sativus OX=3659 PE=1 SV=1
sp|Q40588|ASO_TOBAC	5.16e-68	2	538	59	557	L-ascorbate oxidase OS=Nicotiana tabacum OX=4097 GN=AAO PE=2 SV=1
sp|P37064|ASO_CUCPM	3.22e-65	2	538	32	530	L-ascorbate oxidase OS=Cucurbita pepo var. melopepo OX=3665 PE=1 SV=1
sp|Q8LPL3|ASO_ARATH	5.03e-65	2	536	52	548	L-ascorbate oxidase OS=Arabidopsis thaliana OX=3702 GN=AAO PE=1 SV=1
sp|P24792|ASO_CUCMA	1.54e-64	2	538	62	560	L-ascorbate oxidase OS=Cucurbita maxima OX=3661 GN=AAO PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000043	0.000000

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1544_02736-t46_1-p1.