CAZyme Information: HMPREF1544_00972-t46_1-p1

Basic Information

• Species: Mucor circinelloides
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor circinelloides
• CAZyme ID: HMPREF1544_00972-t46_1-p1
• CAZy Family: AA6
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367		43347.07	5.8493

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mcircinelloides1006PhL	12410	1220926	183	12227

• Gene Location: location=KE123902:150060-151213(+)

Full Sequence      

MSTKLLTSCTLDQVVESTPEDLVLSKVFSETMGPSKVIPYYFRATENFDNEEVTIATLVT
YNRFKVLSRLASHYKGPVSVAIHVNDDDTKQKILTDLHQLYEENEDLRRYVDLHLVVDKF
DRQFNMWRNVAKFFARTDYIMMLDVDFYLCTDFRESLKRNPELMELLRSGRGAIVVPAFE
YVDENDGEDWNDFPKNKKELLVDVGTERLDMFHRGWKRGHGSTNYGKWYKQTKPYKVTDY
NYSYEPYVIFKKEGTPWCDERFVGYGANKAACLFEIFLAGIDYWVLPDDFLIHQTHHYPE
DTRAKERTYNKKLYDYYREETCLRYARMMIAADEWETAKAANLKKECGRIRGFNDVIQKV
AAEHNEL

Enzyme Prediction     

No EC number prediction in HMPREF1544_00972-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT49	46	317	2.9e-46	0.8071216617210683

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404735	Glyco_transf_49	2.04e-58	53	325	2	326	Glycosyl-transferase for dystroglycan. This glycosyl-transferase brings about the glycosylation of the alpha-dystroglycan subunit. Dystroglycan is an integral member of the skeletal muscular dystrophin glycoprotein complex, which links dystrophin to proteins in the extracellular matrix.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS06289.1|GT49	9.45e-213	16	360	80	424
CDS14203.1|GT49	5.19e-199	20	360	86	427
CDS09884.1|GT49	1.25e-174	20	357	53	390
CDS06217.1|GT49	5.33e-172	15	353	89	427
CDS08021.1|GT49	8.60e-160	35	353	3	330

PDB Hits     

HMPREF1544_00972-t46_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9Z1M7|LARG1_MOUSE	3.69e-31	49	296	470	708	Xylosyl- and glucuronyltransferase LARGE1 OS=Mus musculus OX=10090 GN=Large1 PE=1 SV=1
sp|Q66PG3|LARG1_CHICK	6.77e-31	49	296	470	708	Xylosyl- and glucuronyltransferase LARGE1 OS=Gallus gallus OX=9031 GN=LARGE1 PE=2 SV=1
sp|O95461|LARG1_HUMAN	1.24e-30	49	296	470	708	Xylosyl- and glucuronyltransferase LARGE1 OS=Homo sapiens OX=9606 GN=LARGE1 PE=1 SV=1
sp|Q66PG2|LARG1_DANRE	3.07e-30	31	296	453	709	Xylosyl- and glucuronyltransferase LARGE1 OS=Danio rerio OX=7955 GN=large1 PE=2 SV=1
sp|Q5XPT3|LARG2_MOUSE	2.28e-29	52	296	402	638	Xylosyl- and glucuronyltransferase LARGE2 OS=Mus musculus OX=10090 GN=Large2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000062	0.000003

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1544_00972-t46_1-p1.