CAZyme Information: HMPREF1544_00141-t46_1-p1

Basic Information

• Species: Mucor circinelloides
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor circinelloides
• CAZyme ID: HMPREF1544_00141-t46_1-p1
• CAZy Family: PL38
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1468		166955.04	7.0291

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mcircinelloides1006PhL	12410	1220926	183	12227

• Gene Location: location=KE123896:477927-482392(-)

Full Sequence      

MATGNYAINKPNTIPNYRLKLDSLARPSSELQQQQHQLASTYFSQDDPAAFAYFQQELLS
PRLQQALLNQATVSDVNNANYVSQQQQQLQDQHHQLLLHQQQQQQQQQQQQQQQQQHYHQ
IQNHTQQQQQQLQQQQHQQQHSHSQKQFIPSIMVPPQSPTLSSYYFENGWVNHYYDPKRR
QYLSSRVDPDYQQRFTKRQDMDILQQQQQQQQQQHLHQQQQLQQQQQQQQQQQQQYFYPR
GNKRSYSTVSNQNEPTLVLSNHQHHTTSNTQSTYLSAAAAAATAAAAVAAVSSTSQPIIP
SQLLQSPTSTSADDWRESLLQYAHNLYSTSPQNPYLLPLLHSLHDAYPNHLPTLLLLACV
YYSYQDYQSSLKYNHLILKYDANYVEAMSNIGTTLRSIGKTTEAERWWYQAVKLRPGYWD
AVENLVGVLCAKNEDTKDDPRYKEALAVCEFVEKFFFKQQPTILKQPLQLPIHQLARLQN
LFYAKGNLKYALGDIQGAQREYEKGLELAFGGIDLLSICNLIVYACNSATTTTAVNTNAD
IPLVLLQPDQAVRILQIVFPRSGGVLPSLFNVNNATSSNTESVSTIQQTNQTTSTILLTL
SKLFQDLMNPTTPELVAAAAHVTFNGKQPSLSVLLPLYYLSLALHPSPSTANNLGIILSN
IPIAVANAAVKLPTVQQAAPLTGTMLAMQYYMYGLQLDPRHPHLYTNLGSLLKDMGHLNE
AVSMYEKAVEYNPRFDVALANLGNAIKDLGRVQDSVQWYRRAVEVNPNFVDAVCGLVNSL
SGVCDWRGRGGVGNEASVDQYGHYFPPAGNNNAKSGWIGHVVDIVEKQLDEGAIWGAGIL
KMLCGNESVGQRLIDQMMDCTGTQQNADVWKSRLAYYASNNDKAKKDEGGWVIRMIERIM
RRLQHKWYIEAYSKGNNTKRIVVTPELAKKYARPLIPSSLASPPVPTVLPFHTFTYPLTA
RQIRLISHRNALRISHTSLNSTWVAPHVYPPPPPPSPRLKLGYISSDFNNHPLSHLMQSV
FGFHDRAKYDVYCYATTPSDNSPYRQKIERESEHFLDVSSWSNQQVVEKVITDGIHILIN
LNGYTKGARNEIFAARPCPVQCSFMGFAGTLGGGWCDWIIADPIVCPPEMVSGEVWRQRG
SIQNAANGDFEGDIDPEEEAQDDFVYTEKFIYMPHSYFVNDHKQGFRDDHHDQALMLHNV
QANEDSIWAVEEEKRWKMRHEVFPNLPDDVVVFANFNQLYKLEPGTFRMWLRILERVPNS
ILWLLRFPPAGEQHLKRCALEWAGPQVAHRVIFTDVAPKHIHIHRGRVADVFLDTPECNA
HTTAADILWSGTPIVTYPKYMHKMCSRVGASIAMATGFGDEMVVMNEKQYEDKAVELATS
LYYSYETSHLGSVSRHGHGSLMELRKKLFLSREQNRLFDTLRWTQNLERGYSEAWKRWVH
GEEFEDMPSTKTESGCIWVKDPDDNVTA

Enzyme Prediction     

No EC number prediction in HMPREF1544_00141-t46_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404688	Glyco_transf_41	7.02e-126	946	1427	28	543	Glycosyl transferase family 41. This family of glycosyltransferases includes O-linked beta-N-acetylglucosamine (O-GlcNAc) transferase, an enzyme which catalyzes the addition of O-GlcNAc to serine and threonine residues. In addition to its function as an O-GlcNAc transferase, human OGT also appears to proteolytically cleave the epigenetic cell-cycle regulator HCF-1.
226428	Spy	8.31e-68	998	1437	259	617	Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones].
276809	TPR	8.77e-16	687	764	20	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
276809	TPR	7.84e-13	704	780	3	79	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
276809	TPR	9.89e-10	353	450	3	93	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS09089.1|GT41	0.0	145	1464	123	1508
CDR49250.1|GT41	0.0	316	1448	730	1987
CDI52495.1|GT41	0.0	300	1385	657	1849
SAM80369.1|GT41	0.0	300	1385	659	1863
CDS82054.1|GT41	0.0	316	1446	681	2037

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5A01_A	1.47e-95	945	1442	182	702	O-GlcNAc transferase from Drososphila melanogaster [Drosophila melanogaster],5A01_B O-GlcNAc transferase from Drososphila melanogaster [Drosophila melanogaster],5A01_C O-GlcNAc transferase from Drososphila melanogaster [Drosophila melanogaster]
6TKA_AAA	1.75e-93	945	1454	183	726	Chain AAA, UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit [Homo sapiens]
5LVV_A	2.92e-93	945	1454	205	748	Human OGT in complex with UDP and fused substrate peptide (Tab1) [Homo sapiens]
5LWV_A	2.92e-93	945	1454	205	748	Human OGT in complex with UDP and fused substrate peptide (HCF1) [Homo sapiens]
5NPR_A	3.52e-93	945	1447	178	712	The human O-GlcNAc transferase in complex with a thiol-linked bisubstrate inhibitor [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9M8Y0|SEC_ARATH	2.31e-102	945	1443	534	960	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC OS=Arabidopsis thaliana OX=3702 GN=SEC PE=1 SV=1
sp|P81436|OGT1_RABIT	3.21e-90	945	1454	502	1045	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Oryctolagus cuniculus OX=9986 GN=OGT PE=1 SV=2
sp|O15294|OGT1_HUMAN	4.34e-90	945	1454	502	1045	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens OX=9606 GN=OGT PE=1 SV=3
sp|Q27HV0|OGT1_PIG	1.08e-89	945	1454	502	1045	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Sus scrofa OX=9823 GN=OGT PE=2 SV=1
sp|Q8CGY8|OGT1_MOUSE	1.46e-89	945	1454	502	1045	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus musculus OX=10090 GN=Ogt PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000059	0.000000

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1544_00141-t46_1-p1.