CAZyme Information: HMPREF1544_00081-t46_1-p1

Basic Information

• Species: Mucor circinelloides
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor circinelloides
• CAZyme ID: HMPREF1544_00081-t46_1-p1
• CAZy Family: AA1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360	KE123896|CGC1	41208.42	4.9052

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mcircinelloides1006PhL	12410	1220926	183	12227

• Gene Location: location=KE123896:294139-295530(+)

Full Sequence      

MSDLEQNYVTWRNKYLRSYEDGLYVYYKEPKENLKEMTCSEAHGYGMLISVSKRNQQDFD
GLYRYYTRFRNSKGLMQWQQKTDRHGRFVPGDEGGENCATDGDVDICTALFVAAKIWGRG
GPHGEIDYRQAATELAGCIYQHCINHQTHMPLIGDWADPGDDAYLLTRPSDFILSGYLIF
YYEDTPRKEQWGQVIAAIVNCIAGQLSLNPQTGLIADFLKLDQNSGLYYPAQGEVLESEH
DKDYNWNSCRVPWRIGHYYMLTKDERVRPILETQAHFFAGQLARGGGDGDCGIKAGYRLD
GSCYVDYTDMAFVAPACFLFWLLGWNVQLEQIQREMKQMEATYFGESIAMLCLLNANVPL

Enzyme Prediction     

EC	3.2.1.4:2	3.2.1.132:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	6	354	1.8e-58	0.9875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396020	Glyco_hydro_8	3.93e-14	11	227	11	209	Glycosyl hydrolases family 8.
225940	BcsZ	2.89e-07	26	299	42	300	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS11283.1|GH8	1.02e-213	1	359	1	362
AXA50804.1|GH8	5.82e-85	4	348	1	344
AYO43757.1|GH8	5.80e-82	16	348	1	332
SAM75117.1|GH8	2.18e-80	4	351	1	352
SHO79065.1|GH8	2.57e-79	4	348	1	339

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XD0_A	1.07e-40	10	315	68	359	Apo Structure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4],5XD0_B Apo Structure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4]
1V5C_A	4.27e-24	8	315	35	335	The crystal structure of the inactive form chitosanase from Bacillus sp. K17 at pH3.7 [Bacillus sp. (in: Bacteria)],1V5D_A The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)],1V5D_B The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)]
7CJU_A	4.78e-24	8	315	41	341	Crystal structure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7CJU_B Crystal structure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7XGQ_A Chain A, chitosanase [Bacillus sp. K17-2],7XGQ_B Chain B, chitosanase [Bacillus sp. K17-2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P19254|GUB_NIACI	3.96e-40	2	315	60	359	Beta-glucanase OS=Niallia circulans OX=1397 GN=bgc PE=3 SV=1
sp|P29019|GUN_BACSZ	2.30e-25	8	354	91	431	Endoglucanase OS=Bacillus sp. (strain KSM-330) OX=72575 PE=1 SV=1
sp|P37699|GUNC_RUMCH	1.07e-20	38	359	96	390	Endoglucanase C OS=Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) OX=394503 GN=celCCC PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000071	0.000000

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1544_00081-t46_1-p1.