CAZyme Information: HMPREF1544_00076-t46_1-p1

Basic Information

• Species: Mucor circinelloides
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor circinelloides
• CAZyme ID: HMPREF1544_00076-t46_1-p1
• CAZy Family: AA1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
751		85891.21	7.2529

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Mcircinelloides1006PhL	12410	1220926	183	12227

• Gene Location: location=KE123896:282107-284663(-)

Full Sequence      

MSTNLRQRRVESEGATEKLSDVDFDDSKKYGKDSTPSQRCPQGHYAAFGILLVIATFVTF
YKIWNPAEVVFDEVHFGKFAGYYLKRTYYFDVHPPLAKLMIAGAGYLLGFDGQYDFANIG
DSYIAHQVPYIGLRALPATLNVICVGLIYGIMKESGYSLAICILTTAMYIFDNAMVTQNR
LILLDSMLLVFILATIYSYIQFRKLRHTSFSAEWWGWLLATGVFMAFTVSVKMVGLFVVA
MIGFSVIYDLWMLLDIKRGLTMNQFLKHFYARAFSLIFVPIVIYLFWFYVHFTILNESGP
GDAFMTTRFQDTLKNSPLKMSALEIHYGDEITMKHKDTNSYLHSHDLHYPLRYEDGRVSS
KGQQVTAVMEPNENCYWRIKPTTEAEGDDNEPRLVKNGDIIQLEHVVTGTNLLTHDVASP
WMPTNEEITTVPLETRYDETLFKIIFDDDDAEVFETHMTSFRLVHEDTKVAVWVHNKKLP
EWGLGQLEVNGNKNALDKTNYWSAQEIKGKNATEINASKNAKELGYMPFIKKFFELQGRM
LSHNAGLTKPHPYQSTPITWPFMIRGVSYWSKEDTRSQIYLTGNLFGWYLSVGGIAVFAG
IMLADVLARRRGIDPIEEPVRHRVLQSAGFFFVGWALHYFPFFLMGRSLFLHHYLPAATI
NYLLLGAMYQFIFVDGIDSPVSFLSRKSKLTRQTSMKAEVSWKVYAAVGVTLLLQIAMFV
YLAPLTYGTPLTVEEVQNHQLLNGWKLQYGK

Enzyme Prediction     

EC	2.4.1.109:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	51	292	1.6e-66	0.9910313901345291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224839	PMT1	0.0	48	751	27	699	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
396786	PMT	1.92e-81	50	296	2	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
406576	PMT_4TMC	2.48e-72	531	743	1	198	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
397103	MIR	3.77e-13	334	502	4	183	MIR domain. The MIR (protein mannosyltransferase, IP3R and RyR) domain is a domain that may have a ligand transferase function.
197746	MIR	4.07e-09	325	381	4	56	Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS13311.1|GT39	0.0	5	684	6	687
QRW02771.1|GT39	2.69e-236	45	690	64	714
QRV73816.1|GT39	2.69e-236	45	690	64	714
QRW16888.1|GT39	2.47e-234	46	690	65	714
SAM85685.1|GT39	6.61e-230	5	682	9	697

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P25_B	5.66e-97	5	657	23	681	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_B Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6P25_A	8.07e-91	51	689	56	683	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_A Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6P28_A	4.91e-09	340	505	23	191	Crystal structure of the MIR domain (aa 337-532) of the S. cerevisiae mannosyltransferase Pmt2 [Saccharomyces cerevisiae]
6ZQP_A	6.52e-09	340	505	40	208	Structure of the Pmt2-MIR domain with bound ligands [Saccharomyces cerevisiae]
1T9F_A	7.23e-07	340	438	22	112	Structural genomics of Caenorhabditis elegans: Structure of a protein with unknown function [Caenorhabditis elegans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59X23|PMT4_CANAL	7.18e-207	1	672	1	688	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT4 PE=2 SV=2
sp|P46971|PMT4_YEAST	1.18e-201	41	675	48	687	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT4 PE=1 SV=1
sp|O42933|PMT4_SCHPO	1.17e-188	50	682	63	702	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ogm4 PE=3 SV=1
sp|O74189|PMT1_CANAL	1.38e-106	45	670	66	687	Dolichyl-phosphate-mannose--protein mannosyltransferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT1 PE=2 SV=1
sp|Q2LZ62|POMT1_DROPS	7.18e-106	51	665	203	829	Protein O-mannosyltransferase 1 OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=rt PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999935	0.000062

TMHMM  Annotations     

Start	End
45	67
87	109
130	152
157	176
181	200
215	248
269	291
586	608
629	651
661	683
704	726