CAZyme Information: HMPREF1541_11078-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_11078-t46_1-p1
• CAZy Family: GT71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
244		26146.07	5.2387

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822717:316757-317536(+)

Full Sequence      

MLSIRFAKLAALFAAVSTVVAAPAQKRQDSCADVHIFLAKGWNEPYPGRQGKLAGSICWS
LDSCDYEDIWFSNTPEDNYCDSVTQGAASGVAQMTAYAQRCPDSKLVLSGYSQGANVAGD
IIGGGGGPFGTPSCEIGWSAGLSRNSSPGNKIAAVLLFGDTRHVGGKPYNHLNGASISSW
NPRTPEALVQFDTYADRIRSFCVQSDAVCAASGPGPFVDDDHLNYFDRYTDEAAGWVRWR
LTQQ

Enzyme Prediction     

No EC number prediction in HMPREF1541_11078-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	30	240	2.7e-36	0.9894179894179894

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	7.62e-22	30	237	1	169	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPL04270.1|CE5	5.05e-75	15	241	6	230
QGI65106.1|CE5	4.27e-74	28	241	21	229
CCT69066.1|CE5	4.27e-74	28	241	21	229
QGI95990.1|CE5	4.27e-74	28	241	21	229
QGI82360.1|CE5	4.27e-74	28	241	21	229

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QOZ_A	1.08e-12	78	242	56	207	Chain A, ACETYL XYLAN ESTERASE [Trichoderma reesei],1QOZ_B Chain B, ACETYL XYLAN ESTERASE [Trichoderma reesei]
2AXE_A	4.54e-10	30	241	1	206	Iodinated Complex Of Acetyl Xylan Esterase At 1.80 Angstroms [Talaromyces purpureogenus]
1BS9_A	4.54e-10	30	241	1	206	Acetylxylan Esterase From P. Purpurogenum Refined At 1.10 Angstroms [Talaromyces purpureogenus]
1G66_A	1.59e-09	31	241	2	206	ACETYLXYLAN ESTERASE AT 0.90 ANGSTROM RESOLUTION [Talaromyces purpureogenus]
1CUZ_A	3.24e-09	30	225	30	191	Chain A, CUTINASE [Fusarium vanettenii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P9WP38|CULP3_MYCTO	1.53e-11	29	241	42	226	Probable carboxylesterase Culp3 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=cut3 PE=3 SV=1
sp|Q99034|AXE1_HYPJE	1.57e-11	78	242	87	238	Acetylxylan esterase OS=Hypocrea jecorina OX=51453 GN=axe1 PE=1 SV=1
sp|P9WP39|CULP3_MYCTU	2.09e-11	29	241	42	226	Probable carboxylesterase Culp3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=cut3 PE=1 SV=1
sp|P0A537|CULP3_MYCBO	2.09e-11	29	241	42	226	Probable carboxylesterase Culp3 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=cut3 PE=3 SV=1
sp|A0A2J8C362|CUTI1_VERDA	8.14e-10	11	241	5	229	Cutinase 11 OS=Verticillium dahliae OX=27337 GN=VD0003_g7577 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000335	0.999628	CS pos: 27-28. Pr: 0.7520

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1541_11078-t46_1-p1.