CAZyme Information: HMPREF1541_10932-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_10932-t46_1-p1
• CAZy Family: GT66
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
673	KB822716|CGC1	73803.22	4.4338

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822716:375644-378106(+)

Full Sequence      

MKATELPVYLINGQQPGPLIEAEEGDELEIFVQNDLPVEQTIHWHGILQDGTPDMDGVPG
VTQFPIPATGNFTYRFSVASEYGFYWYHSHFRAYYNDAIRGPLIIHPSSSRRRPFESLAE
DKAELSKMLQAERGAIPVVLADWYHRPSDIVYGEYFTTGAFPQCVDSLLANGQGRVRCLP
QNVLQAGPGLGIQSDVANDPHDSVPMDSTMSMPSMSDTSNSDMPMPTSTTTALISMDSSM
SMRKRSEHSSMSMSDSMPTDTSTASPTGTSNPDMTTMSGMSDISTLGPKGCSMPMMFKPG
FNASSLPQETCSNTTSDVFMFDVDASRGWAALHLVNAAAVSRMSVSLDGHSMIVYAADGL
YVEPQEIKVLHISIGQRYSVMVKLDQQPAMYSLRFASYPYGDMQQVIEGYALMSYKNTSM
DSQMTVVEDPALSWMLVNGSAKLDAPELDDHNLPPFESVTPPTGSPDLTQLFSINQTGIV
TWVISDQPYSEPRRPIIYGNASDAWESATTLHLPGNSTVDLVMHVANDSMDVMGHPIHLH
GHKFWFLGAGEGMFPYDSVDAAPSSMINLKNPPFRDTIDLPASGWAVIRYVTDNPGAWLL
HCHVQWHLVSGMAVVLVENEQQLFGMVGSIDNAANNPNMTSMENRGAPLTLEATQSIFLF
ATILFTTFTVFYG

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA1	7	178	5.7e-50	0.43575418994413406
AA1	250	613	3.4e-43	0.6480446927374302

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
274555	ascorbase	1.81e-57	5	618	19	523	L-ascorbate oxidase, plant type. Members of this protein family are the copper-containing enzyme L-ascorbate oxidase (EC 1.10.3.3), also called ascorbase. This family is found in flowering plants, and shows greater sequence similarity to a family of laccases (EC 1.10.3.2) from plants than to other known ascorbate oxidases.
259919	CuRO_1_Abr2_like	6.50e-54	7	106	18	117	The first cupredoxin domain of a group of fungal Laccases similar to Abr2 from Aspergillus fumigatus. Abr2 is involved in conidial pigment biosynthesis in Aspergillus fumigatus. Laccase is a blue multi-copper enzyme that catalyzes the oxidation of a variety aromatic - notably phenolic and inorganic substances coupled to the reduction of molecular oxygen to water. Laccase has been implicated in a wide spectrum of biological activities and, in particular, plays a key role in morphogenesis, development and lignin metabolism in fungi and plants. Like other related multicopper oxidases (MCOs), laccase is composed of three cupredoxin domains that include one mononuclear and one trinuclear copper center. The copper ions are bound in several sites: Type 1, Type 2, and/or Type 3. The ensemble of types 2 and 3 copper is called a trinuclear cluster. MCOs oxidize their substrate by accepting electrons at a mononuclear copper center and transferring them to the active site trinuclear copper center. The cupredoxin domain 1 of 3-domain MCOs contains part the trinuclear copper binding site, which is located at the interface of domains 1 and 3.
177843	PLN02191	2.81e-52	8	648	44	574	L-ascorbate oxidase
215324	PLN02604	3.53e-50	8	630	45	558	oxidoreductase
274556	laccase	1.70e-47	7	619	23	521	laccase, plant. Members of this protein family include the copper-containing enzyme laccase (EC 1.10.3.2), often several from a single plant species, and additional, uncharacterized, closely related plant proteins termed laccase-like multicopper oxidases. This protein family shows considerable sequence similarity to the L-ascorbate oxidase (EC 1.10.3.3) family. Laccases are enzymes of rather broad specificity, and classification of all proteins scoring about the trusted cutoff of this model as laccases may be appropriate.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOD95012.1|AA1	1.61e-249	7	645	46	660
QLI72976.1|AA1	7.44e-245	8	629	52	657
QPG98040.1|AA1	3.33e-242	8	623	46	638
ATY66532.1|AA1	6.16e-225	5	634	54	636
UPL00042.1|AA1	1.37e-223	8	589	40	601

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1HFU_A	4.28e-37	10	637	27	479	Chain A, LACCASE 1 [Coprinopsis cinerea]
1A65_A	4.34e-37	10	637	27	479	Chain A, Laccase [Coprinopsis cinerea]
1AOZ_A	4.39e-37	11	623	27	528	Refined Crystal Structure Of Ascorbate Oxidase At 1.9 Angstroms Resolution [Cucurbita pepo var. melopepo],1AOZ_B Refined Crystal Structure Of Ascorbate Oxidase At 1.9 Angstroms Resolution [Cucurbita pepo var. melopepo],1ASO_A X-Ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-Forms [Cucurbita pepo var. melopepo],1ASO_B X-Ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-Forms [Cucurbita pepo var. melopepo],1ASP_A X-ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-forms [Cucurbita pepo var. melopepo],1ASP_B X-ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-forms [Cucurbita pepo var. melopepo],1ASQ_A X-Ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-Forms [Cucurbita pepo var. melopepo],1ASQ_B X-Ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-Forms [Cucurbita pepo var. melopepo]
5EHF_A	9.81e-37	7	619	23	468	Laccase from Antrodiella faginea [Antrodiella faginea]
3KW7_A	3.55e-36	12	619	28	473	Crystal structure of LacB from Trametes sp. AH28-2 [Trametes sp. AH28-2],3KW7_B Crystal structure of LacB from Trametes sp. AH28-2 [Trametes sp. AH28-2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|W3X732|PFMAY_PESFW	1.65e-89	7	623	42	567	Laccase PFICI_06862 OS=Pestalotiopsis fici (strain W106-1 / CGMCC3.15140) OX=1229662 GN=PFICI_06862 PE=3 SV=1
sp|E9RBR0|ABR2_ASPFU	6.81e-76	8	618	40	571	Laccase abr2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=abr2 PE=1 SV=1
sp|A0A443HK79|VDTB1_BYSSP	1.97e-67	12	618	44	585	Multicopper oxidase VdtB OS=Byssochlamys spectabilis OX=264951 GN=VdtB PE=1 SV=1
sp|A0A0B4HQH6|MLAC1_METMF	6.86e-67	12	618	48	598	Laccase 1 OS=Metarhizium majus (strain ARSEF 297) OX=1276143 GN=Mlac1 PE=3 SV=1
sp|A0A0B4GLB5|MLAC1_METGA	9.32e-67	12	618	47	597	Laccase 1 OS=Metarhizium guizhouense (strain ARSEF 977) OX=1276136 GN=Mlac1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000000

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1541_10932-t46_1-p1.